Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.89
PubTator Score 52.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 2.7e-29
osteosarcoma 7950 1.2e-06
inflammatory breast cancer 286 3.3e-04
adult high grade glioma 3801 4.7e-04
Disease Target Count Z-score Confidence
Learning disability 17 3.605 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma -1.100 4.7e-04
inflammatory breast cancer -1.600 3.3e-04
lung carcinoma 2.000 2.7e-29
osteosarcoma -2.040 1.2e-06

Synonym

Accession Q8NDC4 Q86Y54
Symbols UTA
rtp
C10orf83
bA548K23.4

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

AA Sequence

MTLTKGSFTYSSGEEYRGEWKEGRRHGFGQLMFADGGTYLGHFENGLFNGFGVLTFSDGSRYEGEFAQGK      1 - 70
FNGVGVFIRYDNMTFEGEFKNGRVDGFGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKS     71 - 140
ARNLTA                                                                    141 - 146
//

Text Mined References (12)

PMID Year Title