Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.59
PubTator Score 52.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.040 0.000
adult high grade glioma -1.100 0.000
inflammatory breast cancer -1.600 0.000
lung carcinoma 2.000 0.000

Synonym

Accession Q8NDC4 Q86Y54
Symbols rtp
C10orf83
bA548K23.4

Gene

PANTHER Protein Class (2)

AA Sequence

MTLTKGSFTYSSGEEYRGEWKEGRRHGFGQLMFADGGTYLGHFENGLFNGFGVLTFSDGSRYEGEFAQGK      1 - 70
FNGVGVFIRYDNMTFEGEFKNGRVDGFGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKS     71 - 140
ARNLTA                                                                    141 - 146
//

Text Mined References (12)

PMID Year Title
25822849 2015 Invertebrate and vertebrate class III myosins interact with MORN repeat-containing adaptor proteins.
25416956 2014 A proteome-scale map of the human interactome network.
22496551 2012 A model of toxic neuropathy in Drosophila reveals a role for MORN4 in promoting axonal degeneration.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17285308 2007 Drosophila retinophilin contains MORN repeats and is conserved in humans.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...