Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.25
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MDPLQKRNPASPSKSSPMTAAETSQEGPAPSQPSYSEQPMMGLSNLSPGPGPSQAVPLPEGLLRQRYREE      1 - 70
KTLEERRWERLEFLQRKKAFLRHVRRRHRDHMAPYAVGREARISPLGDRSQNRFRCECRYCQSHRPNLSG     71 - 140
IPGESNRAPHPSSWETLVQGLSGLTLSLGTNQPGPLPEAALQPQETEEKRQRERQQESKIMFQRLLKQWL    141 - 210
EEN                                                                       211 - 213
//

Text Mined References (9)

PMID Year Title