Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.25
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MDPLQKRNPASPSKSSPMTAAETSQEGPAPSQPSYSEQPMMGLSNLSPGPGPSQAVPLPEGLLRQRYREE      1 - 70
KTLEERRWERLEFLQRKKAFLRHVRRRHRDHMAPYAVGREARISPLGDRSQNRFRCECRYCQSHRPNLSG     71 - 140
IPGESNRAPHPSSWETLVQGLSGLTLSLGTNQPGPLPEAALQPQETEEKRQRERQQESKIMFQRLLKQWL    141 - 210
EEN                                                                       211 - 213
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16382448 2006 Identification of a new cancer/testis gene family, CT47, among expressed multicopy genes on the human X chromosome.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.