Property Summary

NCBI Gene PubMed Count 47
PubMed Score 29.46
PubTator Score 39.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 1.080 2.5e-02
Chronic Lymphocytic Leukemia -2.005 8.0e-04
colon cancer -2.800 1.3e-02
cutaneous lupus erythematosus 2.200 3.3e-02
Endometriosis -1.791 5.7e-03
interstitial cystitis 1.500 4.2e-02
intraductal papillary-mucinous adenoma (... 3.000 3.1e-04
intraductal papillary-mucinous carcinoma... 1.500 1.7e-02
lung cancer -2.600 7.4e-05
malignant mesothelioma -3.500 1.7e-08
nasopharyngeal carcinoma -1.500 3.0e-03
non-small cell lung cancer -1.369 9.6e-15
osteosarcoma -2.696 2.9e-06
primary Sjogren syndrome 2.900 9.9e-05
spina bifida -1.217 3.6e-02
tuberculosis and treatment for 3 months 1.100 8.1e-03
ulcerative colitis 1.900 4.5e-03
urothelial carcinoma -1.600 5.8e-03
Waldenstrons macroglobulinemia 1.560 3.1e-02

Gene RIF (45)

AA Sequence

MLPAAPGKGLGSPDPAPCGPAPPGNTKDIIMIYEEDAEEWALYLTEVFLHVVKREAILLYRLENFSFRHL      1 - 70
ELLNLTSYKCKLLILSNSLLRDLTPKKCQFLEKILHSPKSVVTLLCGVKSSDQLYELLNISQSRWEISTE     71 - 140
QEPEDYISVIQSIIFKDSEDYFEVNIPTDLRAKHSGEISERKEIEELSEASRNTIPLAVVLPTEIPCENP    141 - 210
GEIFIILRDEVIGDTVEVEFTSSNKRIRTRPALWNKKVWCMKALEFPAGSVHVNVYCDGIVKATTKIKYY    211 - 280
PTAKAKECLFRMADSGESLCQNSIEELDGVLTSIFKHEIPYYEFQSLQTEICSQNKYTHFKELPTLLHCA    281 - 350
AKFGLKNLAIHLLQCSGATWASKMKNMEGSDPAHIAERHGHKELKKIFEDFSIQEIDINNEQENDYEEDI    351 - 420
ASFSTYIPSTQNPAFHHESRKTYGQSADGAEANEMEGEGKQNGSGMETKHSPLEVGSESSEDQYDDLYVF    421 - 490
IPGADPENNSQEPLMSSRPPLPPPRPVANAFQLERPHFTLPGTMVEGQMERSQNWGHPGVRQETGDEPKG    491 - 560
EKEKKEEEKEQEEEEDPYTFAEIDDSEYDMILANLSIKKKTGSRSFIINRPPAPTPRPTSIPPKEETTPY    561 - 630
IAQVFQQKTARRQSDDDKFCGLPKKQDRARIESPAFSTLRGCLTDGQEELILLQEKVKNGKMSMDEALEK    631 - 700
FKHWQMGKSGLEMIQQEKLRQLRDCIIGKRPEEENVYNKLTIVHHPGGKETAHNENKFYNVHFSNKLPAR    701 - 770
PQVEKEFGFCCKKDH                                                           771 - 785
//

Text Mined References (49)

PMID Year Title