Property Summary

NCBI Gene PubMed Count 41
Grant Count 12
Funding $1,314,002.36
PubMed Score 27.10
PubTator Score 39.81

Knowledge Summary

Patent

No data available

Expression

Gene RIF (39)

PMID Text
25608828 Data show that single-nucleotide polymorphism rs3733197 located in the coding region of BANK1 (B-cell scaffold protein with ankyrin repeats 1) was significantly associated with serum LDL cholesterols.
24879116 Authors identified a novel balanced reciprocal translocation, t(4;14)(q24;q32.) Sequence analysis identified the partner gene as BANK1.
24342660 BANK1 and IL15 as new T1D genetic susceptibility factors.
24127308 Our findings suggest the existence of association between BANK1 gene and autoimmune thyroid diseases
24085759 Our study confirms evidence for epistasis between BLK and BANK1 in systemic lupus erythematosis from a Chinese population for the first time.
23899688 SNPs of the FAM167A-BLK region, but not the BANK1 SNPs, were associated with the development of primary Sjogren's syndrome in Han Chinese.
23646104 This study confirms BANK1 as an RA susceptibility gene and for the first time provides evidence for epistasis between BANK1 and BLK in RA.
23555801 BANK1 and BLK have roles in B-cell signaling through phospholipase C gamma 2
23065315 This study did not reveal a major role for BANK1 in humoral autoimmunity in chronic arthritis.
22003931 allelic variation in BANK1 does not play a major role in determining multifocal motor neuropathy susceptibility.
More...

AA Sequence

MLPAAPGKGLGSPDPAPCGPAPPGNTKDIIMIYEEDAEEWALYLTEVFLHVVKREAILLYRLENFSFRHL      1 - 70
ELLNLTSYKCKLLILSNSLLRDLTPKKCQFLEKILHSPKSVVTLLCGVKSSDQLYELLNISQSRWEISTE     71 - 140
QEPEDYISVIQSIIFKDSEDYFEVNIPTDLRAKHSGEISERKEIEELSEASRNTIPLAVVLPTEIPCENP    141 - 210
GEIFIILRDEVIGDTVEVEFTSSNKRIRTRPALWNKKVWCMKALEFPAGSVHVNVYCDGIVKATTKIKYY    211 - 280
PTAKAKECLFRMADSGESLCQNSIEELDGVLTSIFKHEIPYYEFQSLQTEICSQNKYTHFKELPTLLHCA    281 - 350
AKFGLKNLAIHLLQCSGATWASKMKNMEGSDPAHIAERHGHKELKKIFEDFSIQEIDINNEQENDYEEDI    351 - 420
ASFSTYIPSTQNPAFHHESRKTYGQSADGAEANEMEGEGKQNGSGMETKHSPLEVGSESSEDQYDDLYVF    421 - 490
IPGADPENNSQEPLMSSRPPLPPPRPVANAFQLERPHFTLPGTMVEGQMERSQNWGHPGVRQETGDEPKG    491 - 560
EKEKKEEEKEQEEEEDPYTFAEIDDSEYDMILANLSIKKKTGSRSFIINRPPAPTPRPTSIPPKEETTPY    561 - 630
IAQVFQQKTARRQSDDDKFCGLPKKQDRARIESPAFSTLRGCLTDGQEELILLQEKVKNGKMSMDEALEK    631 - 700
FKHWQMGKSGLEMIQQEKLRQLRDCIIGKRPEEENVYNKLTIVHHPGGKETAHNENKFYNVHFSNKLPAR    701 - 770
PQVEKEFGFCCKKDH                                                           771 - 785
//

Text Mined References (43)

PMID Year Title
25608828 2015 A nonsynonymous SNP in BANK1 is associated with serum LDL cholesterol levels in three Korean populations.
24879116 2014 Inactivation of BANK1 in a novel IGH-associated translocation t(4;14)(q24;q32) suggests a tumor suppressor role in B-cell lymphoma.
24342660 2014 Association of BANK1 and cytokine gene polymorphisms with type 1 diabetes in Tunisia.
24127308 2013 Genetic variants of BANK1 gene in autoimmune thyroid diseases: a case-control association study.
24085759 2013 Genetic interactions between BANK1 and BLK in Chinese patients with systemic lupus erythematosus.
23899688 Polymorphisms in the FAM167A-BLK, but not BANK1, are associated with primary Sjögren's syndrome in a Han Chinese population.
23646104 2013 Epistatic interaction between BANK1 and BLK in rheumatoid arthritis: results from a large trans-ethnic meta-analysis.
23555801 2013 BANK1 and BLK act through phospholipase C gamma 2 in B-cell signaling.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
23273568 2013 Meta-analysis followed by replication identifies loci in or near CDKN1B, TET3, CD80, DRAM1, and ARID5B as associated with systemic lupus erythematosus in Asians.
More...