Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.700 8.3e-06
Astrocytoma, Pilocytic -1.100 1.6e-05
atypical teratoid / rhabdoid tumor -2.000 1.2e-09
Breast cancer 1.400 9.1e-07
ependymoma -1.300 8.7e-08
glioblastoma -1.300 1.6e-06
group 4 medulloblastoma -1.700 5.8e-06
invasive ductal carcinoma 2.100 2.4e-02
medulloblastoma, large-cell -2.300 1.2e-06
non-small cell lung cancer 1.048 1.2e-11
osteosarcoma -1.120 4.2e-04
ovarian cancer 1.500 3.5e-06
pituitary cancer -1.100 7.3e-03
primitive neuroectodermal tumor -1.500 6.7e-05
spina bifida -1.505 4.4e-02

Gene RIF (1)

AA Sequence

MTESSMKKLASTLLDAITDKDPLVQEQVCSALCSLGEARPVETLRACEEYLRQHDKLAHPYRAAVLRAME      1 - 70
RVLSSRASELDKDTASTIILLASSEMTKTKDLVWDWQQAASGVLVAVGRQFISKVMEELLRRLHPGTLPH     71 - 140
CAVLHTLASLSVANAFGVVPFLPSVLSSLLPVLGVAKQDTVRVAFCSALQRFSEGALEYLANLDRAPDPT    141 - 210
VRKDAFATDIFSAYDVLFHQWLQSREAKLRLAVVEALGPMSHLLPSERLEEQLPKLLPGILALYKKHAET    211 - 280
FYLSKSLGQILEAAVSVGSRTLETQLDALLAALHSQICVPVESSSPLVMSNQKEVLRCFTVLACSSPDRL    281 - 350
LAFLLPRLDTSNERTRVGTLQVVRHVINSAAAQMEDKKPFILSSMRLPLLDTNSKVKRAVVQVISAMAHH    351 - 420
GYLEQPGGEAMIEYIVQQCALPPEQEPEKPGPGSKDPKADSVRAISVRTLYLVSTTVDRMSHVLWPYLLQ    421 - 490
FLTPVRFTGALTPLCRSLVHLAQKRQEAGADAFLIQYDAHASLPSPYAVTGRLLVVSSSPYLGDGRGAAA    491 - 560
LRLLSVLHPNIHPLLGQHWETTVPLLLGYLDEHTEETLPQEEWEEKLLMFLRDTLAIISDNAWICQLSLE    561 - 630
LCRQLPCYDEAPQEKNFLYKCIGTTLGAASSKEVVRKHLQELLETARYQEEAEREGLACCFGICAISHLE    631 - 700
DTLAQLEDFVRSEVFRKSIGILNIFKDRSENEVEKVKSALILCYGHVAARAPRELVLAKVESDILRNICQ    701 - 770
HFSTKVLGIKVETKDPALKLCLVQSVCMVSRAICSSTQAGSFHFTRKAELVAQMMEFIRAEPPDSLRTPI    771 - 840
RKKAMLTCTYLVSVEPALDEQARADVIHGCLHSIMALLPEPKEEDGGCQKSLYLETLHALEDLLTSLLQR    841 - 910
NMTPQGLQIMIEHLSPWIKSPRGHERARALGLSALLLRYFLEHLRVSALVPFHNLGLLIGLFSPRCADLW    911 - 980
PATRQEAVDCVYSLLYLQLGYEGFSRDYRDDVAERLLSLKDGLVHPDPAILFHTCHSVGQIIAKRLPPDQ    981 - 1050
LISLLLTMFEALGDPEKNCSRAATVMINCLLQERGGVLQEKVPEIVSVLRSKLQEAQGEHVLPAAQHSVY   1051 - 1120
LLATQHCAAVVSSLLGSPLPLDSHTCMLWRALAVEPRLAAQVLGLLLEKMSRDVPFKESRAFLLGRTPDR   1121 - 1190
VATLLPLSATCALFEVMSTPAAGPAVLELYPQLFVVLLLRVSCTVGVQLPRNLQAQERRGASPALATRNL   1191 - 1260
EPCSSAVDTLRSMLLRSGSEDVVQRMDLEGGWELLRTSAGHEEGATRLARAMAEHAGPRLPLVLKTLACT   1261 - 1330
HSSAYENQRVTTTAFLAELLNSNVANDLMLLDSLLESLAARQKDTCASVRRLVLRGLANLASGCPDKVRT   1331 - 1400
HGPQLLTAMIGGLDDGDNPHSPVALEAMLGLARLVHLVESWDLRSGLLHVAIRIRPFFDSEKMEFRTASI   1401 - 1470
RLFGHLNKVCHGDCEDVFLDQVVGGLAPLLLHLQDPQATVASACRFALRMCGPNLACEELSAAFQKHLQE   1471 - 1540
GRALHFGEFLNTTCKHLMHHFPDLLGRLLTTCLFYFKSSWENVRAAAPLFTGFLVLHSEPRQQPQVDLDQ   1541 - 1610
LIAALQILLKDPAPEVRTRAAEALGRLVKLA                                          1611 - 1641
//

Text Mined References (10)

PMID Year Title