Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.67
PubTator Score 1.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 2.14177499568958E-42
non-small cell lung cancer 2798 6.72348546991864E-9
Breast cancer 3099 2.0451655814092E-8
lung adenocarcinoma 2714 2.12442249852273E-8
osteosarcoma 7933 2.31447488375213E-5
atypical teratoid/rhabdoid tumor 1095 0.00707543661173866
facioscapulohumeral dystrophy 286 0.0236089564816526
oligodendroglioma 2849 0.0464109034010989

Expression

  Differential Expression (8)

Disease log2 FC p
oligodendroglioma 1.300 0.046
osteosarcoma -3.606 0.000
non-small cell lung cancer -1.292 0.000
lung adenocarcinoma -1.100 0.000
atypical teratoid/rhabdoid tumor -1.600 0.007
Breast cancer -2.200 0.000
psoriasis -1.100 0.000
facioscapulohumeral dystrophy 1.400 0.024

Synonym

Accession Q8ND83 A8K0Z9 B7Z209 Q5T6P4 Q5T6P7 Q8ND10 Q96NV0
Symbols C13orf32

Gene

  Ortholog (10)

Gene RIF (1)

PMID Text
16546155 Expressed at the stem cell and epiblast stages of embryonic stem cell differentiation.

AA Sequence

MMAEQVKCASAGVSSGAGSGPVVNAELEVKKLQELVRKLEKQNEQLRSRAASAAAAPHLLLLPPPPPAAP      1 - 70
PPAGLQPLGPRSPPAATATAAASGGLGPAFPGTFCLPSPAPSLLCSLAQPPEAPFVYFKPAAGFFGAGGG     71 - 140
GPEPGGAGTPPGAAAAPPSPPPTLLDEVELLDLESVAAWRDEDDYTWLYIGSSKTFTSSEKSLTPLQWCR    141 - 210
HVLDNPTPEMEAARRSLCFRLEQGYTSRGSPLSPQSSIDSELSTSELEDDSISMGYKLQDLTDVQIMARL    211 - 280
QEESLRQDYASTSASVSRHSSSVSLSSGKKGTCSDQEYDQYSLEDEEEFDHLPPPQPRLPRCSPFQRGIP    281 - 350
HSQTFSSIRECRRSPSSQYFPSNNYQQQQYYSPQAQTPDQQPNRTNGDKLRRSMPNLARMPSTTAISSNI    351 - 420
SSPVTVRNSQSFDSSLHGAGNGISRIQSCIPSPGQLQHRVHSVGHFPVSIRQPLKATAYVSPTVQGSSNM    421 - 490
PLSNGLQLYSNTGIPTPNKAAASGIMGRSALPRPSLAINGSNLPRSKIAQPVRSFLQPPKPLSSLSTLRD    491 - 560
GNWRDGCY                                                                  561 - 568
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16546155 2006 Transcriptional profiling of mouse and human ES cells identifies SLAIN1, a novel stem cell gene.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.