Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.75
PubTator Score 1.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.600 7.1e-03
Breast cancer -2.200 2.0e-08
facioscapulohumeral dystrophy 1.400 2.4e-02
lung adenocarcinoma -1.100 2.1e-08
non-small cell lung cancer -1.292 6.7e-09
oligodendroglioma 1.300 4.6e-02
osteosarcoma -3.606 2.3e-05
psoriasis -1.100 2.1e-42

Gene RIF (1)

AA Sequence

MMAEQVKCASAGVSSGAGSGPVVNAELEVKKLQELVRKLEKQNEQLRSRAASAAAAPHLLLLPPPPPAAP      1 - 70
PPAGLQPLGPRSPPAATATAAASGGLGPAFPGTFCLPSPAPSLLCSLAQPPEAPFVYFKPAAGFFGAGGG     71 - 140
GPEPGGAGTPPGAAAAPPSPPPTLLDEVELLDLESVAAWRDEDDYTWLYIGSSKTFTSSEKSLTPLQWCR    141 - 210
HVLDNPTPEMEAARRSLCFRLEQGYTSRGSPLSPQSSIDSELSTSELEDDSISMGYKLQDLTDVQIMARL    211 - 280
QEESLRQDYASTSASVSRHSSSVSLSSGKKGTCSDQEYDQYSLEDEEEFDHLPPPQPRLPRCSPFQRGIP    281 - 350
HSQTFSSIRECRRSPSSQYFPSNNYQQQQYYSPQAQTPDQQPNRTNGDKLRRSMPNLARMPSTTAISSNI    351 - 420
SSPVTVRNSQSFDSSLHGAGNGISRIQSCIPSPGQLQHRVHSVGHFPVSIRQPLKATAYVSPTVQGSSNM    421 - 490
PLSNGLQLYSNTGIPTPNKAAASGIMGRSALPRPSLAINGSNLPRSKIAQPVRSFLQPPKPLSSLSTLRD    491 - 560
GNWRDGCY                                                                  561 - 568
//

Text Mined References (11)

PMID Year Title