Property Summary

NCBI Gene PubMed Count 33
Grant Count 172
R01 Count 1
Funding $66,754,584.59
PubMed Score 27.83
PubTator Score 18.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 2.000 0.000
astrocytic glioma -1.300 0.015
ependymoma -1.200 0.019
glioblastoma multiforme -1.600 0.000
oligodendroglioma -1.100 0.000
osteosarcoma -1.677 0.000
cystic fibrosis 1.063 0.001
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma -1.500 0.000
medulloblastoma, large-cell -1.600 0.000
primitive neuroectodermal tumor -1.100 0.001
pancreatic ductal adenocarcinoma liver m... -1.302 0.008
tuberculosis 1.200 0.000
adult high grade glioma -1.400 0.017
ovarian cancer 3.000 0.000

Synonym

Accession Q8ND76 B7ZKX9 D3DRY9 Q2M3V4 Q2TU96 Q6NT86 Q7Z4U7 Q8TEX2 Q8TEX3 Q96M99 Q96P45 Cyc-Y
Symbols CCNX
CFP1
CBCP1
C10orf9

Gene

Gene RIF (17)

PMID Text
26205494 Activation of PCTAIRE-1 is mediated through interaction with the phosphorylated form of cyclin Y in complex with 14-3-3.
24824184 Our findings highlight a PFTK1-CCNY complex in activating noncanonical Wnt signaling in HCC cells.
24794231 Human cyclin Y (CCNY) is a phosphoprotein in vivo and phosphorylation of CCNY by CDK14 triggers its ubiquitination and degradation.
22895054 Cyclin Y regulates the expression and membrane trafficing of PCTAIRE kinases (PCTK). (Review)
22184064 CCNY binding to CDK16 required a region upstream of the kinase domain and was found to be inhibited by phosphorylation of serine 153, a potential PKA phosphorylation site.
21273179 these results validated the role of CCNY as a clinically relevant human oncoprotein
20886065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20441050 CCNY might play an important role in glioma tumorigenisis.
20176734 Observational study of gene-disease association. (HuGE Navigator)
19422935 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MGNTTSCCVSSSPKLRRNAHSRLESYRPDTDLSREDTGCNLQHISDRENIDDLNMEFNPSDHPRASTIFL      1 - 70
SKSQTDVREKRKSLFINHHPPGQIARKYSSCSTIFLDDSTVSQPNLKYTIKCVALAIYYHIKNRDPDGRM     71 - 140
LLDIFDENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICPA    141 - 210
NWKRIVLGAILLASKVWDDQAVWNVDYCQILKDITVEDMNELERQFLELLQFNINVPSSVYAKYYFDLRS    211 - 280
LAEANNLSFPLEPLSRERAHKLEAISRLCEDKYKDLRRSARKRSASADNLTLPRWSPAIIS             281 - 341
//

Text Mined References (42)

PMID Year Title
26205494 2015 Cyclin Y phosphorylation- and 14-3-3-binding-dependent activation of PCTAIRE-1/CDK16.
24824184 2014 PFTK1 interacts with cyclin Y to activate non-canonical Wnt signaling in hepatocellular carcinoma.
24794231 2014 Phosphorylation of cyclin Y by CDK14 induces its ubiquitination and degradation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22895054 2012 Orphan kinases turn eccentric: a new class of cyclin Y-activated, membrane-targeted CDKs.
22184064 2012 Cyclin-dependent kinase 16/PCTAIRE kinase 1 is activated by cyclin Y and is essential for spermatogenesis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
More...