Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.26
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.10230200254999E-23
lung adenocarcinoma 2714 1.1049495095872E-15
lung carcinoma 2844 1.16988911457997E-10
juvenile dermatomyositis 1189 9.28874225347474E-10
pilocytic astrocytoma 3086 1.6963430506835E-6
breast carcinoma 1614 1.20253918207338E-5
primary Sjogren syndrome 789 2.07068704987755E-5
hepatocellular carcinoma 550 2.50844204773816E-5
ulcerative colitis 2087 2.82580673205233E-5
invasive ductal carcinoma 2950 1.79640935572165E-4
ductal carcinoma in situ 1745 1.87600355460609E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00115514693313084
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00156907870804244
ovarian cancer 8492 0.00185298688359132
gastric cancer 436 0.00440232308650399
pancreatic cancer 2300 0.00457787233114851
pancreatic carcinoma 567 0.00457787233114853
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00488404815437788
osteosarcoma 7933 0.00562178836550719
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00636770221950728
interstitial cystitis 2299 0.00999410105174357
Pick disease 1893 0.0176749918831354
subependymal giant cell astrocytoma 2287 0.0283430946031957
adrenocortical carcinoma 1427 0.031065032742882
pulmonary arterial hypertension 36 0.0408938251951851
mucosa-associated lymphoid tissue lymphoma 480 0.0425722782661319

Expression

Synonym

Accession Q8ND71
Symbols IAN6
IAN9
IANT
IAN-9

Gene

  Ortholog (8)

Pathway (1)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSEQSCQMSELRLLLLGKCRSGKSATGNAILGKHVFKSKFSDQTVIKMCQRESWVLRERKVVVIDTPDLF      1 - 70
SSIACAEDKQRNIQHCLELSAPSLHALLLVIAIGHFTREDEETAKGIQQVFGAEARRHIIIVFTRKDDLG     71 - 140
DDLLQDFIEKNKPLKQLVQDYEGRYCIFNNKTNSKDEQITQVLELLRKVESLVNTNGGPYHVNFKTEGSR    141 - 210
FQDCVNEAASQEGDKPQGPRERQLQSTGPEQNPGTSELTVLLVGKRGAGKSAAGNSILGRQAFQTGFSEQ    211 - 280
SVTQSFLSESRSWRKKKVSIIDAPDISSLKNIDSEVRKHICTGPHAFLLVTPLGFYTKNDEAVLSTIQNN    281 - 350
FGEKFFEYMIILLTRKEDLGDQDLDTFLRNSNKALYGLIQKCKNRYSAFNYRATGEEEQRQADELLEKIE    351 - 420
SMVHQNGNKHCVFREKETLNIVLVGRSGTGKSATGNSILGSLVFTSRLRAQPVTKTSQSGRRTWDGQEVV    421 - 490
VVDTPSFNQMLDVEKDPSRLEEEVKRCLSCCEKGDTFFVLVFQLGRFTEEDKTAVAKLEAIFGADFTKYA    491 - 560
IMLFTRKEDLGAGNLEDFMKNSDNKALRRIFKKCGRRVCAFNNKETGQAQETQVKALLTKVNDLRKESGW    561 - 630
SGYPHTQENVSKLIKNVQEMSQAEKLLKNLIGILQ                                       631 - 665
//

Text Mined References (13)

PMID Year Title
23454188 2013 Structural insights into the mechanism of GTPase activation in the GIMAP family.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16103028 2005 Expression of the Ian family of putative GTPases during T cell development and description of an Ian with three sets of GTP/GDP-binding motifs.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474311 2004 Comparative analysis of the human gimap gene cluster encoding a novel GTPase family.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
More...