Property Summary

NCBI Gene PubMed Count 15
PubMed Score 15.57
PubTator Score 10.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.228 0.037
Multiple myeloma 2.050 0.001
psoriasis -1.600 0.000
osteosarcoma -1.915 0.000
posterior fossa group B ependymoma 1.200 0.000
Amyotrophic Lateral Sclerosis 1.107 0.000
atypical teratoid/rhabdoid tumor 1.300 0.000
group 3 medulloblastoma 1.200 0.009
ovarian cancer 2.000 0.003
dermatomyositis 1.400 0.001

Synonym

Accession Q8ND56 B4DTG6 Q76LX7 Q96AR3 Q96K73 Q96SN5 Q9UFR3
Symbols RAP55
FAM61A
RAP55A
C19orf13

Gene

Gene RIF (5)

PMID Text
26339800 RAP55/LSM14 binds directly the tubulin and that is implicated in the process of the mitotic spindle stabilization
22973032 The NS1 protein of influenza A virus interacts with cellular processing bodies and stress granules through RNA-associated protein 55 (RAP55) during virus infection.
22745163 LSm14A is a processing body-associated sensor of viral nucleic acids that initiates cellular antiviral response in the early phase of viral infection.
22614839 RAP55 is important for the assembly of cytoplasmic mRNP granules and that PRMT1 is required for RAP55A to localize to P-bodies.
18723115 this protein family has evolved a common and fundamental role in the control of mRNA translation. Human RAP55A is an autoantigen detected in the serum of patients with primary biliary cirrhosis (PBC).

AA Sequence

MSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGS      1 - 70
DIKDLTVCEPPKPQCSLPQDPAIVQSSLGSSTSSFQSMGSYGPFGRMPTYSQFSPSSLVGQQFGAVGVAG     71 - 140
SSLTSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSPTMEQAVQTASAHLPAPA    141 - 210
AVGRRSPVSTRPLPSASQKAGENQEHRRAEVHKVSRPENEQLRNDNKRQVAPGAPSAPRRGRGGHRGGRG    211 - 280
RFGIRRDGPMKFEKDFDFESANAQFNKEEIDREFHNKLKLKEDKLEKQEKPVNGEDKGDSGVDTQNSEGN    281 - 350
ADEEDPLGPNCYYDKTKSFFDNISCDDNRERRPTWAEERRLNAETFGIPLRPNRGRGGYRGRGGLGFRGG    351 - 420
RGRGGGRGGTFTAPRGFRGGFRGGRGGREFADFEYRKTTAFGP                               421 - 463
//

Text Mined References (31)

PMID Year Title
26339800 2015 Localization and role of RAP55/LSM14 in HeLa cells: a new finding on the mitotic spindle assembly.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22973032 2012 The NS1 protein of influenza A virus interacts with cellular processing bodies and stress granules through RNA-associated protein 55 (RAP55) during virus infection.
22745163 2012 LSm14A is a processing body-associated sensor of viral nucleic acids that initiates cellular antiviral response in the early phase of viral infection.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22614839 2012 PRMT1 is required for RAP55 to localize to processing bodies.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...