Property Summary

NCBI Gene PubMed Count 17
PubMed Score 16.03
PubTator Score 10.86

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
Amyotrophic lateral sclerosis 1.107 6.2e-06
atypical teratoid/rhabdoid tumor 1.300 2.4e-06
dermatomyositis 1.400 8.8e-04
ependymoma 1.100 1.6e-10
group 3 medulloblastoma 1.200 8.7e-03
Multiple myeloma 2.050 5.1e-04
osteosarcoma -1.915 2.6e-06
ovarian cancer -1.800 1.2e-06
psoriasis -1.600 6.8e-05
Waldenstrons macroglobulinemia 1.228 3.7e-02

Gene RIF (7)

AA Sequence

MSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGS      1 - 70
DIKDLTVCEPPKPQCSLPQDPAIVQSSLGSSTSSFQSMGSYGPFGRMPTYSQFSPSSLVGQQFGAVGVAG     71 - 140
SSLTSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSPTMEQAVQTASAHLPAPA    141 - 210
AVGRRSPVSTRPLPSASQKAGENQEHRRAEVHKVSRPENEQLRNDNKRQVAPGAPSAPRRGRGGHRGGRG    211 - 280
RFGIRRDGPMKFEKDFDFESANAQFNKEEIDREFHNKLKLKEDKLEKQEKPVNGEDKGDSGVDTQNSEGN    281 - 350
ADEEDPLGPNCYYDKTKSFFDNISCDDNRERRPTWAEERRLNAETFGIPLRPNRGRGGYRGRGGLGFRGG    351 - 420
RGRGGGRGGTFTAPRGFRGGFRGGRGGREFADFEYRKTTAFGP                               421 - 463
//

Text Mined References (33)

PMID Year Title