Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.04
PubTator Score 6.69

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
26443449 rs12791447 is associated with prostate cancer susceptibility in Asians. mRNA levels of PPFIBP2 are differentially expressed in prostate tumours and paired normal tissues.
22328529 Knockdown of either Rab17 or liprin-beta2 restores invasiveness of ERK2-depleted cells, indicating that ERK2 drives invasion of MDA-MB-231 cells by suppressing expression of these genes.
21462929 analysis of crystal structure of the central coiled-coil domain from human liprin-beta2
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20095854 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MASDASHALEAALEQMDGIIAGTKTGADLSDGTCEPGLASPASYMNPFPVLHLIEDLRLALEMLELPQER      1 - 70
AALLSQIPGPTAAYIKEWFEESLSQVNHHSAASNETYQERLARLEGDKESLILQVSVLTDQVEAQGEKIR     71 - 140
DLEVCLEGHQVKLNAAEEMLQQELLSRTSLETQKLDLMTEVSELKLKLVGMEKEQREQEEKQRKAEELLQ    141 - 210
ELRHLKIKVEELENERNQYEWKLKATKAEVAQLQEQVALKDAEIERLHSQLSRTAALHSESHTERDQEIQ    211 - 280
RLKMGMETLLLANEDKDRRIEELTGLLNQYRKVKEIVMVTQGPSERTLSINEEEPEGGFSKWNATNKDPE    281 - 350
ELFKQEMPPRCSSPTVGPPPLPQKSLETRAQKKLSCSLEDLRSESVDKCMDGNQPFPVLEPKDSPFLAEH    351 - 420
KYPTLPGKLSGATPNGEAAKSPPTICQPDATGSSLLRLRDTESGWDDTAVVNDLSSTSSGTESGPQSPLT    421 - 490
PDGKRNPKGIKKFWGKIRRTQSGNFYTDTLGMAEFRRGGLRATAGPRLSRTRDSKGQKSDANAPFAQWST    491 - 560
ERVCAWLEDFGLAQYVIFARQWVSSGHTLLTATPQDMEKELGIKHPLHRKKLVLAVKAINTKQEEKSALL    561 - 630
DHIWVTRWLDDIGLPQYKDQFHESRVDRRMLQYLTVNDLLFLKVTSQLHHLSIKCAIHVLHVNKFNPHCL    631 - 700
HRRPADESNLSPSEVVQWSNHRVMEWLRSVDLAEYAPNLRGSGVHGGLIILEPRFTGDTLAMLLNIPPQK    701 - 770
TLLRRHLTTKFNALIGPEAEQEKREKMASPAYTPLTTTAKVRPRKLGFSHFGNIRKKKFDESTDYICPME    771 - 840
PSDGVSDSHRVYSGYRGLSPLDAPELDGLDQVGQIS                                      841 - 876
//

Text Mined References (21)

PMID Year Title
26443449 2015 Large-scale association analysis in Asians identifies new susceptibility loci for prostate cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22328529 2012 ERK2 drives tumour cell migration in three-dimensional microenvironments by suppressing expression of Rab17 and liprin-?2.
21462929 2011 Crystal structure of the central coiled-coil domain from human liprin-?2.
21207424 2011 Molecular markers of endometrial carcinoma detected in uterine aspirates.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20095854 2010 Novel breast cancer risk alleles and interaction with ionizing radiation among U.S. radiologic technologists.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...