Property Summary

NCBI Gene PubMed Count 19
Grant Count 2
Funding $176,906
PubMed Score 4.87
PubTator Score 4.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.600 0.004
ependymoma -1.900 0.010
oligodendroglioma -1.100 0.025
osteosarcoma -2.074 0.000
glioblastoma -1.200 0.001
medulloblastoma, large-cell -1.700 0.002
tuberculosis and treatment for 6 months -1.600 0.000
intraductal papillary-mucinous adenoma (... 1.300 0.000
intraductal papillary-mucinous neoplasm ... 1.400 0.003
group 4 medulloblastoma 1.100 0.001
spina bifida -1.780 0.048
ovarian cancer 2.800 0.000

Synonym

Accession Q8ND25 D3DUJ9 Q9H083
Symbols NIN283

Gene

 Grant Application (2)

Gene RIF (5)

PMID Text
25819896 rs17684886 (ZNRF1) and rs599019 (COLEC12) are associated with diabetic retinopathy and rs6427247 (SCYL1BP1) and rs899036 (API5) are associated with severe diabetic retinopathy in Chinese patients with type 2 diabetes
22797923 ZNRF1 and ZNRF2 are new players in regulation of the ubiquitous Na(+)/K(+)ATPase that is tuned to changing demands in many physiological contexts.
19844255 Observational study of gene-disease association. (HuGE Navigator)
19737534 These results suggest that ZNRF1 mediates regulation of neuritogenesis via interaction with tubulin.
14561866 data suggest that ZNRF proteins play a role in the establishment and maintenance of neuronal transmission and plasticity via their ubiquitin ligase activity

AA Sequence

MGGKQSTAARSRGPFPGVSTDDSAVPPPGGAPHFGHYRTGGGAMGLRSRSVSSVAGMGMDPSTAGGVPFG      1 - 70
LYTPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSH     71 - 140
SGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTKDAGECVICLEELLQGDTIARLPCLCIYHKSC    141 - 210
IDSWFEVNRSCPEHPAD                                                         211 - 227
//

Text Mined References (22)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
25819896 2015 Common variants in or near ZNRF1, COLEC12, SCYL1BP1 and API5 are associated with diabetic retinopathy in Chinese patients with type 2 diabetes.
23665963 2013 Multidimensional prognostic risk assessment identifies association between IL12B variation and surgery in Crohn's disease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22797923 2012 ZNRF2 is released from membranes by growth factors and, together with ZNRF1, regulates the Na+/K+ATPase.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
19737534 2009 ZNRF1 interacts with tubulin and regulates cell morphogenesis.
19690564 2009 A comprehensive framework of E2-RING E3 interactions of the human ubiquitin-proteasome system.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
More...