Property Summary

NCBI Gene PubMed Count 19
PubMed Score 5.22
PubTator Score 4.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.600 3.9e-03
ependymoma -1.900 1.0e-02
glioblastoma -1.100 3.1e-03
group 4 medulloblastoma 1.100 1.5e-03
intraductal papillary-mucinous adenoma (... 1.300 2.6e-04
intraductal papillary-mucinous neoplasm ... 1.400 3.0e-03
medulloblastoma, large-cell -1.700 1.6e-03
oligodendroglioma -1.100 2.5e-02
osteosarcoma -2.074 2.6e-05
ovarian cancer 2.800 7.5e-08
spina bifida -1.780 4.8e-02
tuberculosis and treatment for 3 months -1.100 3.6e-05

Gene RIF (5)

AA Sequence

MGGKQSTAARSRGPFPGVSTDDSAVPPPGGAPHFGHYRTGGGAMGLRSRSVSSVAGMGMDPSTAGGVPFG      1 - 70
LYTPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSH     71 - 140
SGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTKDAGECVICLEELLQGDTIARLPCLCIYHKSC    141 - 210
IDSWFEVNRSCPEHPAD                                                         211 - 227
//

Text Mined References (22)

PMID Year Title