Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.34
PubTator Score 5.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
malignant mesothelioma 3163 7.01417887996061E-7
medulloblastoma, large-cell 6234 1.22068917436071E-5
nasopharyngeal carcinoma 1056 3.46120078745295E-5
ovarian cancer 8492 1.87975549501108E-4
psoriasis 6685 3.03007208275615E-4
dermatomyositis 967 3.69447142805939E-4
Disease Target Count Z-score Confidence
Visceral heterotaxy 12 0.0 4.0
Disease Target Count Z-score Confidence
Primary ciliary dyskinesia 75 3.503 1.8

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
psoriasis 1.200 0.000
medulloblastoma, large-cell -1.500 0.000
nasopharyngeal carcinoma 1.700 0.000
ovarian cancer -1.300 0.000
dermatomyositis 1.300 0.000

Synonym

Accession Q8NCW6 B3KWF4 Q6PCD1 Q9H6C2 Q9H6Z5 Q9UDR8
Symbols GALNACT11
GALNAC-T11

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
C. elegans OMA Inparanoid

Gene RIF (5)

PMID Text
25493955 possible role in the deterioration of kidney function [meta-analysis]
24076351 evidence suggests that CLL patient samples harbor aberrant O-glycosylation highlighted by Tn antigen expression and that the over-expression of GALNT11 constitutes a new molecular marker for CLL
20547088 Single nucleiotide polymorphism in the GALNT11 genes were investigated to assess allele frequencies in different populations. This SNP would be useful marker for forensic individualization, in particular, as ancestry-informative markers.
20547088 Observational study of genotype prevalence. (HuGE Navigator)
20422447 GALNT11, the human ortholog to Drosophila melanogaster pgant35A, was shown not to support rescue of the l(2)35Aa lethality during Drosophila embryogenesis.

AA Sequence

MGSVTVRYFCYGCLFTSATWTVLLFVYFNFSEVTQPLKNVPVKGSGPHGPSPKKFYPRFTRGPSRVLEPQ      1 - 70
FKANKIDDVIDSRVEDPEEGHLKFSSELGMIFNERDQELRDLGYQKHAFNMLISDRLGYHRDVPDTRNAA     71 - 140
CKEKFYPPDLPAASVVICFYNEAFSALLRTVHSVIDRTPAHLLHEIILVDDDSDFDDLKGELDEYVQKYL    141 - 210
PGKIKVIRNTKREGLIRGRMIGAAHATGEVLVFLDSHCEVNVMWLQPLLAAIREDRHTVVCPVIDIISAD    211 - 280
TLAYSSSPVVRGGFNWGLHFKWDLVPLSELGRAEGATAPIKSPTMAGGLFAMNRQYFHELGQYDSGMDIW    281 - 350
GGENLEISFRIWMCGGKLFIIPCSRVGHIFRKRRPYGSPEGQDTMTHNSLRLAHVWLDEYKEQYFSLRPD    351 - 420
LKTKSYGNISERVELRKKLGCKSFKWYLDNVYPEMQISGSHAKPQQPIFVNRGPKRPKVLQRGRLYHLQT    421 - 490
NKCLVAQGRPSQKGGLVVLKACDYSDPNQIWIYNEEHELVLNSLLCLDMSETRSSDPPRLMKCHGSGGSQ    491 - 560
QWTFGKNNRLYQVSVGQCLRAVDPLGQKGSVAMAICDGSSSQQWHLEG                          561 - 608
//

Text Mined References (15)

PMID Year Title
25493955 2015 Genome-wide association study of kidney function decline in individuals of European descent.
24226769 2013 The heterotaxy gene GALNT11 glycosylates Notch to orchestrate cilia type and laterality.
24076351 2014 GALNT11 as a new molecular marker in chronic lymphocytic leukemia.
21282601 2011 Rare copy number variations in congenital heart disease patients identify unique genes in left-right patterning.
20547088 2010 A Japanese-specific allele in the GALNT11 gene.
20422447 2010 Rescue of Drosophila Melanogaster l(2)35Aa lethality is only mediated by polypeptide GalNAc-transferase pgant35A, but not by the evolutionary conserved human ortholog GalNAc-transferase-T11.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...