Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.39
PubTator Score 5.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
malignant mesothelioma 3232 7.0e-07
medulloblastoma, large-cell 6241 1.2e-05
nasopharyngeal carcinoma 1058 3.5e-05
ovarian cancer 8520 1.9e-04
psoriasis 6694 3.0e-04
dermatomyositis 966 3.7e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Visceral heterotaxy 14 0.0 4.0
Disease Target Count Z-score Confidence
Oligohydramnios 52 3.278 1.6
Astigmatism 54 3.032 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
dermatomyositis 1.300 3.7e-04
malignant mesothelioma -1.400 7.0e-07
medulloblastoma, large-cell -1.500 1.2e-05
nasopharyngeal carcinoma 1.700 3.5e-05
ovarian cancer -1.300 1.9e-04
psoriasis 1.200 3.0e-04

Gene RIF (5)

AA Sequence

MGSVTVRYFCYGCLFTSATWTVLLFVYFNFSEVTQPLKNVPVKGSGPHGPSPKKFYPRFTRGPSRVLEPQ      1 - 70
FKANKIDDVIDSRVEDPEEGHLKFSSELGMIFNERDQELRDLGYQKHAFNMLISDRLGYHRDVPDTRNAA     71 - 140
CKEKFYPPDLPAASVVICFYNEAFSALLRTVHSVIDRTPAHLLHEIILVDDDSDFDDLKGELDEYVQKYL    141 - 210
PGKIKVIRNTKREGLIRGRMIGAAHATGEVLVFLDSHCEVNVMWLQPLLAAIREDRHTVVCPVIDIISAD    211 - 280
TLAYSSSPVVRGGFNWGLHFKWDLVPLSELGRAEGATAPIKSPTMAGGLFAMNRQYFHELGQYDSGMDIW    281 - 350
GGENLEISFRIWMCGGKLFIIPCSRVGHIFRKRRPYGSPEGQDTMTHNSLRLAHVWLDEYKEQYFSLRPD    351 - 420
LKTKSYGNISERVELRKKLGCKSFKWYLDNVYPEMQISGSHAKPQQPIFVNRGPKRPKVLQRGRLYHLQT    421 - 490
NKCLVAQGRPSQKGGLVVLKACDYSDPNQIWIYNEEHELVLNSLLCLDMSETRSSDPPRLMKCHGSGGSQ    491 - 560
QWTFGKNNRLYQVSVGQCLRAVDPLGQKGSVAMAICDGSSSQQWHLEG                          561 - 608
//

Text Mined References (15)

PMID Year Title