Property Summary

NCBI Gene PubMed Count 15
Grant Count 4
R01 Count 1
Funding $269,367.53
PubMed Score 11.63
PubTator Score 6.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
lung adenocarcinoma 1.200 0.000
lung carcinoma 2.000 0.000
Breast cancer 1.200 0.000
invasive ductal carcinoma 1.300 0.000
ovarian cancer 1.800 0.000

Synonym

Accession Q8NCW5 B4DGY3 Q496C6 Q5T3I2
Symbols AIBP
PEBEL
YJEFN1
APOA1BP

Gene

Gene RIF (7)

PMID Text
26114227 AIBp contributes to mitotic entry and bipolar spindle assembly.
23719382 AIBP accelerates cholesterol efflux from endothelial cells to HDL and thereby regulates angiogenesis
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20855565 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
17521614 Taken together, the current study demonstrates that APN might protect against atherosclerosis by increasing HDL assembly through enhancing ABCA1 pathway and apoA-1 synthesis in the liver.

AA Sequence

MSRLRALLGLGLLVAGSRVPRIKSQTIACRSGPTWWGPQRLNSGGRWDSEVMASTVVKYLSQEEAQAVDQ      1 - 70
ELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVLVICGPGNNGGDGLVCARHLKLFGYEPTI     71 - 140
YYPKRPNKPLFTALVTQCQKMDIPFLGEMPAEPMTIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGL    141 - 210
TVPIASIDIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPD    211 - 280
TECVYRLQ                                                                  281 - 288
//

Text Mined References (20)

PMID Year Title
26114227 2015 AIBp regulates mitotic entry and mitotic spindle assembly by controlling activation of both Aurora-A and Plk1.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23719382 2013 Control of angiogenesis by AIBP-mediated cholesterol efflux.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
21994945 2011 Extremely conserved ATP- or ADP-dependent enzymatic system for nicotinamide nucleotide repair.
21269460 2011 Initial characterization of the human central proteome.
More...