Property Summary

NCBI Gene PubMed Count 16
PubMed Score 14.26
PubTator Score 6.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 1.200 1.5e-14
invasive ductal carcinoma 1.300 8.0e-05
lung adenocarcinoma 1.200 1.2e-09
lung carcinoma 2.000 3.1e-23
ovarian cancer 1.800 4.2e-05

Gene RIF (8)

AA Sequence

MSRLRALLGLGLLVAGSRVPRIKSQTIACRSGPTWWGPQRLNSGGRWDSEVMASTVVKYLSQEEAQAVDQ      1 - 70
ELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVLVICGPGNNGGDGLVCARHLKLFGYEPTI     71 - 140
YYPKRPNKPLFTALVTQCQKMDIPFLGEMPAEPMTIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGL    141 - 210
TVPIASIDIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPD    211 - 280
TECVYRLQ                                                                  281 - 288
//

Text Mined References (22)

PMID Year Title