Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.50
PubTator Score 3.09

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
breast carcinoma 1.200 0.001
inflammatory breast cancer 1.700 0.045
psoriasis -1.100 0.000

Synonym

Accession Q8NCW0 B4DXF6 I3L2S2 Q8N2J4 Q8NCW1 Q96GL8 Q9BTP9
Symbols KRM2

Gene

PANTHER Protein Class (1)

Gene RIF (1)

PMID Text
20846389 The mRNA expression levels of DKK-1 binding receptor LRP5/6 and Krm1/2 in SCs from patients with MM were significantly higher than those in myeloma cells and in SCs from healthy donors.

AA Sequence

MGTQALQGFLFLLFLPLLQPRGASAGSLHSPGLSECFQVNGADYRGHQNRTGPRGAGRPCLFWDQTQQHS      1 - 70
YSSASDPHGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPSCHMPGYLGCFVDSGAPPALSGP     71 - 140
SGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLARGRLAPATDCDQICFGHPGQLCGGDGRLG    141 - 210
VYEVSVGSCQGNWTAPQGVIYSPDFPDEYGPDRNCSWALGPPGAALELTFRLFELADPRDRLELRDAASG    211 - 280
SLLRAFDGARPPPSGPLRLGTAALLLTFRSDARGHAQGFALTYRGLQDAAEDPEAPEGSAQTPAAPLDGA    281 - 350
NVSCSPRPGAPPAAIGARVFSTVTAVSVLLLLLLGLLRPLRRRSCLLAPGKGPPALGASRGPRRSWAVWY    351 - 420
QQPRGVALPCSPGDPQAEGSAAGYRPLSASSQSSLRSLISAL                                421 - 462
//

Text Mined References (8)

PMID Year Title
20846389 2010 Differential expression of DKK-1 binding receptors on stromal cells and myeloma cells results in their distinct response to secreted DKK-1 in myeloma.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12050670 2002 Kremen proteins are Dickkopf receptors that regulate Wnt/beta-catenin signalling.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.