Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.64
PubTator Score 3.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 9.9e-13
malignant mesothelioma 3232 1.0e-04
breast carcinoma 1638 1.2e-03
inflammatory breast cancer 286 4.5e-02

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma 1.200 1.2e-03
inflammatory breast cancer 1.700 4.5e-02
malignant mesothelioma 1.200 1.0e-04
psoriasis -1.100 9.9e-13

Protein-protein Interaction (2)

Gene RIF (1)

AA Sequence

MGTQALQGFLFLLFLPLLQPRGASAGSLHSPGLSECFQVNGADYRGHQNRTGPRGAGRPCLFWDQTQQHS      1 - 70
YSSASDPHGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPSCHMPGYLGCFVDSGAPPALSGP     71 - 140
SGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLARGRLAPATDCDQICFGHPGQLCGGDGRLG    141 - 210
VYEVSVGSCQGNWTAPQGVIYSPDFPDEYGPDRNCSWALGPPGAALELTFRLFELADPRDRLELRDAASG    211 - 280
SLLRAFDGARPPPSGPLRLGTAALLLTFRSDARGHAQGFALTYRGLQDAAEDPEAPEGSAQTPAAPLDGA    281 - 350
NVSCSPRPGAPPAAIGARVFSTVTAVSVLLLLLLGLLRPLRRRSCLLAPGKGPPALGASRGPRRSWAVWY    351 - 420
QQPRGVALPCSPGDPQAEGSAAGYRPLSASSQSSLRSLISAL                                421 - 462
//

Text Mined References (8)

PMID Year Title