Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 0.000
group 4 medulloblastoma -1.500 0.002
medulloblastoma, large-cell -1.600 0.000

AA Sequence

MLANDVRHQQEMWGFRKVEGGVVQSLGKSSVEGETDGTISEFREIQRLAAFASFLSHAPPLNARRLLTPP      1 - 70
PRRRPRCTPAAAMADVSERTLQLSVLVAFASGVLLGWQANRLRRRYLDWRKRRLQDKLAATQKKLDLA       71 - 138
//

Text Mined References (4)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24059539 2013 Combining in silico prediction and ribosome profiling in a genome-wide search for novel putatively coding sORFs.
23305238 2013 Top down proteomics of human membrane proteins from enriched mitochondrial fractions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.