Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.85
PubTator Score 2.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (4)

PMID Text
23522043 An endoplasmic reticulum protein, NLF-1, delivers a sodium leak channel critical for rhythmic locomotion.
20818381 Single nucleotide polymorphism in C2CD4A is associated with type 2 diabetes.
20818381 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
15527968 NLF1 may play a role in regulating genes which control cellular architecture.

AA Sequence

MWCLERLRLGPECLRRSGDWLLPGRARGAKSRTTAACANVLTPDRIPEFCIPPRLMPRLALAALRNSWVE      1 - 70
EAGMDEGAGRTDWDPRSQAALSLPHLPRVRTAYGFCALLESPHTRRKESLLLGGPPAPRPRAHTYGGGGG     71 - 140
PDALLGTLRVPRAPGPATPAAPGCPRPPQDALARRPRGCRLLRVPDGLLSRALRAGRSRRLTRVRSVSSG    141 - 210
NEDKERRAGSQSPARAPSTSPPSSRVPFPERLEAEGTVALGRAGDALRLAAEYCPGTGRLRLRLLRAESP    211 - 280
AGGAPGPRAVSCRLSLVLRPPGTALRQCSTVVGRSRKASFDQDFCFDGLSEDEVRRLAVRVKARDEGRGR    281 - 350
ERGRLLGQGELSLGALLLL                                                       351 - 369
//

Text Mined References (10)

PMID Year Title
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
23945395 2014 Genome-wide association study identifies three novel loci for type 2 diabetes.
23522043 2013 NLF-1 delivers a sodium leak channel to regulate neuronal excitability and modulate rhythmic locomotion.
21873549 2011 Genome-wide association identifies nine common variants associated with fasting proinsulin levels and provides new insights into the pathophysiology of type 2 diabetes.
21799836 2011 A genome-wide association study confirms previously reported loci for type 2 diabetes in Han Chinese.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20818381 2010 A genome-wide association study in the Japanese population identifies susceptibility loci for type 2 diabetes at UBE2E2 and C2CD4A-C2CD4B.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16341674 2005 Transcriptome analysis of human gastric cancer.
15527968 2004 A novel gene family induced by acute inflammation in endothelial cells.