Tdark | C2 calcium-dependent domain-containing protein 4A |
May be involved in inflammatory process. May regulate cell architecture and adhesion.
Comments
Disease | Target Count |
---|---|
Diabetes Mellitus, Non-Insulin-Dependent | 161 |
Disease | Target Count | P-value |
---|---|---|
psoriasis | 6685 | 2.60155690760912E-19 |
ulcerative colitis | 2087 | 2.00082838878841E-8 |
non-small cell lung cancer | 2798 | 1.79111239399879E-7 |
head and neck cancer | 270 | 2.67295756935455E-6 |
pituitary cancer | 1972 | 3.67823298108514E-6 |
intraductal papillary-mucinous carcinoma (IPMC) | 2988 | 4.30845826204295E-4 |
Breast cancer | 3099 | 0.00374789519255079 |
intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 0.00435950065255577 |
active Crohn's disease | 918 | 0.0069750389057721 |
Endometriosis | 535 | 0.0174787487949682 |
ductal carcinoma in situ | 1745 | 0.0254813192211421 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Acquired metabolic disease | 267 | 0.0 | 2.0 |
Type 2 diabetes mellitus | 192 | 0.0 | 2.0 |
Disease | log2 FC | p |
---|---|---|
non-small cell lung cancer | 1.271 | 0.000 |
intraductal papillary-mucinous carcinoma... | 3.500 | 0.000 |
intraductal papillary-mucinous neoplasm ... | 2.800 | 0.004 |
active Crohn's disease | 4.110 | 0.007 |
ulcerative colitis | 4.000 | 0.000 |
Endometriosis | -2.284 | 0.017 |
Breast cancer | 1.500 | 0.004 |
ductal carcinoma in situ | 1.500 | 0.025 |
pituitary cancer | -3.700 | 0.000 |
head and neck cancer | 1.600 | 0.000 |
psoriasis | 1.500 | 0.000 |
PMID | Text |
---|---|
23522043 | An endoplasmic reticulum protein, NLF-1, delivers a sodium leak channel critical for rhythmic locomotion. |
20818381 | Single nucleotide polymorphism in C2CD4A is associated with type 2 diabetes. |
20818381 | Observational study and genome-wide association study of gene-disease association. (HuGE Navigator) |
15527968 | NLF1 may play a role in regulating genes which control cellular architecture. |
MWCLERLRLGPECLRRSGDWLLPGRARGAKSRTTAACANVLTPDRIPEFCIPPRLMPRLALAALRNSWVE 1 - 70 EAGMDEGAGRTDWDPRSQAALSLPHLPRVRTAYGFCALLESPHTRRKESLLLGGPPAPRPRAHTYGGGGG 71 - 140 PDALLGTLRVPRAPGPATPAAPGCPRPPQDALARRPRGCRLLRVPDGLLSRALRAGRSRRLTRVRSVSSG 141 - 210 NEDKERRAGSQSPARAPSTSPPSSRVPFPERLEAEGTVALGRAGDALRLAAEYCPGTGRLRLRLLRAESP 211 - 280 AGGAPGPRAVSCRLSLVLRPPGTALRQCSTVVGRSRKASFDQDFCFDGLSEDEVRRLAVRVKARDEGRGR 281 - 350 ERGRLLGQGELSLGALLLL 351 - 369 //
PMID | Year | Title |
---|---|---|
24509480 | 2014 | Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility. |
23945395 | 2014 | Genome-wide association study identifies three novel loci for type 2 diabetes. |
23522043 | 2013 | NLF-1 delivers a sodium leak channel to regulate neuronal excitability and modulate rhythmic locomotion. |
21873549 | 2011 | Genome-wide association identifies nine common variants associated with fasting proinsulin levels and provides new insights into the pathophysiology of type 2 diabetes. |
21799836 | 2011 | A genome-wide association study confirms previously reported loci for type 2 diabetes in Han Chinese. |
20881960 | 2010 | Hundreds of variants clustered in genomic loci and biological pathways affect human height. |
20818381 | 2010 | A genome-wide association study in the Japanese population identifies susceptibility loci for type 2 diabetes at UBE2E2 and C2CD4A-C2CD4B. |
16572171 | 2006 | Analysis of the DNA sequence and duplication history of human chromosome 15. |
16341674 | 2005 | Transcriptome analysis of human gastric cancer. |
15527968 | 2004 | A novel gene family induced by acute inflammation in endothelial cells. |