Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.19
PubTator Score 2.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
active Crohn's disease 4.110 7.0e-03
active ulcerative colitis 3.693 4.5e-03
Breast cancer 1.500 3.7e-03
ductal carcinoma in situ 1.500 2.5e-02
Endometriosis -2.284 1.7e-02
head and neck cancer 1.600 2.7e-06
intraductal papillary-mucinous carcinoma... 3.500 4.3e-04
intraductal papillary-mucinous neoplasm ... 2.800 4.4e-03
non-small cell lung cancer 1.271 1.8e-07
pituitary cancer -3.700 3.7e-06
psoriasis 1.500 2.6e-19

Synonym

Accession Q8NCU7
Symbols NLF1
FAM148A

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (6)

AA Sequence

MWCLERLRLGPECLRRSGDWLLPGRARGAKSRTTAACANVLTPDRIPEFCIPPRLMPRLALAALRNSWVE      1 - 70
EAGMDEGAGRTDWDPRSQAALSLPHLPRVRTAYGFCALLESPHTRRKESLLLGGPPAPRPRAHTYGGGGG     71 - 140
PDALLGTLRVPRAPGPATPAAPGCPRPPQDALARRPRGCRLLRVPDGLLSRALRAGRSRRLTRVRSVSSG    141 - 210
NEDKERRAGSQSPARAPSTSPPSSRVPFPERLEAEGTVALGRAGDALRLAAEYCPGTGRLRLRLLRAESP    211 - 280
AGGAPGPRAVSCRLSLVLRPPGTALRQCSTVVGRSRKASFDQDFCFDGLSEDEVRRLAVRVKARDEGRGR    281 - 350
ERGRLLGQGELSLGALLLL                                                       351 - 369
//

Text Mined References (12)

PMID Year Title