Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
non primary Sjogren syndrome sicca 840

Synonym

Accession Q8NCU1 Q8N7S1
Symbols C14orf48
c14_5713

Gene

 Compartment GO Term (0)

AA Sequence

MDTGQRADPSNPGDKEGDLQGLWQELYQLQAKQKKLKREVEKHKLFEDYLIKVLEKIPEGCTGWEEPEEV      1 - 70
LVEATVKHYGKLFTASQDTQKRLEAFCQMIQAVHRSLESLEEDHRALIASRSGCVSCRRSATASRSSGGS     71 - 140
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15014966 2004 Sequence organization and matrix attachment regions of the human serine protease inhibitor gene cluster at 14q32.1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.