Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q8NCU1 Q8N7S1
Symbols C14orf48
c14_5713
LINC00521

Gene

 Compartment GO Term (0)

AA Sequence

MDTGQRADPSNPGDKEGDLQGLWQELYQLQAKQKKLKREVEKHKLFEDYLIKVLEKIPEGCTGWEEPEEV      1 - 70
LVEATVKHYGKLFTASQDTQKRLEAFCQMIQAVHRSLESLEEDHRALIASRSGCVSCRRSATASRSSGGS     71 - 140
//

Text Mined References (6)

PMID Year Title