Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 1.07118355041009E-17
malignant mesothelioma 3163 1.47048604457834E-4
ovarian cancer 8492 8.674673610565E-4
cutaneous lupus erythematosus 1056 0.00289896208321411
ulcerative colitis 2087 0.0030973040027694
ductal carcinoma in situ 1745 0.00343528196026074
psoriasis 6685 0.00441532313596372
group 4 medulloblastoma 1875 0.00506109602211594
active Crohn's disease 918 0.0112375936982942
posterior fossa group B ependymoma 1530 0.0142512447032043
subependymal giant cell astrocytoma 2287 0.0205853213754248

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
cutaneous lupus erythematosus -1.800 0.003
psoriasis -1.600 0.004
active Crohn's disease 1.406 0.011
ulcerative colitis 1.500 0.003
group 4 medulloblastoma 1.600 0.005
posterior fossa group B ependymoma 1.100 0.014
subependymal giant cell astrocytoma -1.398 0.021
lung carcinoma 1.100 0.000
ductal carcinoma in situ 1.400 0.003
ovarian cancer -1.400 0.001

Synonym

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid

AA Sequence

MAGCTRKLTHLRKRIHRPRRRTTRRWKRWFKFRKRKGEKRPRPNHKAVARRAKLKFSTSEKLHWPEQELA      1 - 70
KKSILNAEDSLIIDNKRSISHLSSGVLKDIFTTGTSSYNVLLQSKEEKKYHSQKQSSSTYSKRCRKPSKS     71 - 140
PNTSRSKDPRRMKALVPVTSSGTWYCLERRPAVFVTSSVSSPVKFTHDISVTGNGIVLPPKPKSKVKWCH    141 - 210
FSTLPKPKPQLSRSFEKGDDFSGKKFCILTAIKPTNLEKEKLRFFKSDYTYNPQFEYANPALPSVLAKHS    211 - 280
HASDRFLKQIVVHLTEDLLSRASMTVVNGCPTLTINVSTAREHWLEGMLRHEIGTHYFRGINNLQQPWNS    281 - 350
WTGRKKHELKPNNPTEEGLASIHSVLFRKDPFLWRAALLYYTVYQASQMSFCELFKDIGRFVKDPNTRWD    351 - 420
YCVRAKRGWTDTSQPGCFSKDQVYLDGILQILRYRDTIDFHLLTALGKVSYEDVDRLKGLAVTENMRVPH    421 - 490
FLQDHGRYMEHLEKIMEVNELTDRELKDLI                                            491 - 520
//

Text Mined References (6)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.