Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
active Crohn's disease 1.406 1.1e-02
active ulcerative colitis 1.421 3.3e-02
cutaneous lupus erythematosus -1.800 2.9e-03
ductal carcinoma in situ 1.400 3.4e-03
group 4 medulloblastoma 1.600 5.1e-03
lung carcinoma 1.100 1.1e-17
malignant mesothelioma -1.200 1.5e-04
ovarian cancer -1.400 8.7e-04
posterior fossa group B ependymoma 1.100 1.4e-02
psoriasis -1.600 4.4e-03
subependymal giant cell astrocytoma -1.398 2.1e-02

AA Sequence

MAGCTRKLTHLRKRIHRPRRRTTRRWKRWFKFRKRKGEKRPRPNHKAVARRAKLKFSTSEKLHWPEQELA      1 - 70
KKSILNAEDSLIIDNKRSISHLSSGVLKDIFTTGTSSYNVLLQSKEEKKYHSQKQSSSTYSKRCRKPSKS     71 - 140
PNTSRSKDPRRMKALVPVTSSGTWYCLERRPAVFVTSSVSSPVKFTHDISVTGNGIVLPPKPKSKVKWCH    141 - 210
FSTLPKPKPQLSRSFEKGDDFSGKKFCILTAIKPTNLEKEKLRFFKSDYTYNPQFEYANPALPSVLAKHS    211 - 280
HASDRFLKQIVVHLTEDLLSRASMTVVNGCPTLTINVSTAREHWLEGMLRHEIGTHYFRGINNLQQPWNS    281 - 350
WTGRKKHELKPNNPTEEGLASIHSVLFRKDPFLWRAALLYYTVYQASQMSFCELFKDIGRFVKDPNTRWD    351 - 420
YCVRAKRGWTDTSQPGCFSKDQVYLDGILQILRYRDTIDFHLLTALGKVSYEDVDRLKGLAVTENMRVPH    421 - 490
FLQDHGRYMEHLEKIMEVNELTDRELKDLI                                            491 - 520
//

Text Mined References (6)

PMID Year Title