Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.81
PubTator Score 4.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Gene RIF (3)

PMID Text
19605364 Txnip regulates cellular metabolism independent of its binding to thioredoxin and the arrestin domains are crucial structural elements in metabolic functions of alpha-arrestin proteins
18976975 Knockdown of arrestin domain containing 4 (ARRDC4) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18307387 identification of variants in the ARRDC4 coding region; seven variants were identified; fifteen haplotypes were inferred; haplotypes form two clades

AA Sequence

MGGEAGCAAAVGAEGRVKSLGLVFEDERKGCYSSGETVAGHVLLEASEPVALRALRLEAQGRATAAWGPS      1 - 70
TCPRASASTAALAVFSEVEYLNVRLSLREPPAGEGIILLQPGKHEFPFRFQLPSEPLVTSFTGKYGSIQY     71 - 140
CVRAVLERPKVPDQSVKRELQVVSHVDVNTPALLTPVLKTQEKMVGCWFFTSGPVSLSAKIERKGYCNGE    141 - 210
AIPIYAEIENCSSRLIVPKAAIFQTQTYLASGKTKTIRHMVANVRGNHIASGSTDTWNGKTLKIPPVTPS    211 - 280
ILDCCIIRVDYSLAVYIHIPGAKKLMLELPLVIGTIPYNGFGSRNSSIASQFSMDMSWLTLTLPEQPEAP    281 - 350
PNYADVVSEEEFSRHIPPYPQPPNCEGEVCCPVFACIQEFRFQPPPLYSEVDPHPSDVEESQPVSFIL      351 - 418
//

Text Mined References (13)

PMID Year Title
23236378 2012 Mammalian ? arrestins link activated seven transmembrane receptors to Nedd4 family e3 ubiquitin ligases and interact with ? arrestins.
23208550 2013 Distinct roles for ?-arrestin2 and arrestin-domain-containing proteins in ?2 adrenergic receptor trafficking.
21982743 2011 The arrestin domain-containing 3 protein regulates body mass and energy expenditure.
21897333 2011 Genes linked to energy metabolism and immunoregulatory mechanisms are associated with subcutaneous adipose tissue distribution in HIV-infected men.
20634892 2010 A genome-wide association study of neuroticism in a population-based sample.
19605364 2009 Thioredoxin-independent regulation of metabolism by the alpha-arrestin proteins.
18307387 2008 An anomalous haplotype distribution of the arrestin domain-containing 4 gene (ARRDC4) haplotypes in Caucasians.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...