Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.77
PubTator Score 2.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma 2.091 1.1e-02
Astrocytoma, Pilocytic 1.300 3.1e-05
atypical teratoid / rhabdoid tumor -1.700 3.6e-02
cystic fibrosis -1.100 1.5e-04
ductal carcinoma in situ 2.200 4.5e-02
glioblastoma 1.100 3.2e-03
interstitial cystitis -1.900 8.2e-04
lung adenocarcinoma 1.100 1.8e-04
non-small cell lung cancer 1.463 7.1e-10
osteosarcoma 1.934 2.1e-03
pediatric high grade glioma 1.100 1.4e-03
posterior fossa group A ependymoma 1.100 1.3e-02
psoriasis 1.200 2.9e-04
type II diabetes mellitus and post-ische... 1.400 1.1e-02

Synonym

Accession Q8NCS7 B5MCU3 Q4G0K0 Q8NA44 Q8NB86
Symbols CTL5

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (7)

Gene RIF (2)

AA Sequence

MNDTEKPADTPSEEEDFGDPRTYDPDFKGPVANRSCTDVLCCMIFLLCIIGYIVLGLVAWVHGDPRRAAY      1 - 70
PTDSQGHFCGQKGTPNENKTILFYFNLLRCTSPSVLLNLQCPTTQICVSKCPEKFLTYVEMQLLYTKDKS     71 - 140
YWEDYRQFCKTTAKPVKSLTQLLLDDDCPTAIFPSKPFLQRCFPDFSTKNGTLTIGSKMMFQDGNGGTRS    141 - 210
VVELGIAANGINKLLDAKSLGLKVFEDYARTWYWILIGLTIAMVLSWIFLILLRFIAGCLFWVFMIGVIG    211 - 280
IIGYGIWHCYQQYTNLQERPSSVLTIYDIGIQTNISMYFELQQTWFTFMIILCIIEVIVILMLIFLRNRI    281 - 350
RVAIILLKEGSKAIGYVPSTLVYPALTFILLSICICYWVVTAVFLATSGVPVYKVIAPGGHCIHENQTCD    351 - 420
PEIFNTTEIAKACPGALCNFAFYGGKSLYHQYIPTFHVYNLFVFLWLINFVIALGQCALAGAFATYYWAM    421 - 490
KKPDDIPRYPLFTAFGRAIRYHTGSLAFGSLIIALIQMFKIVLEYLDHRLKRTQNTLSKFLQCCLRCCFW    491 - 560
CLENAIKFLNRNAYIMIAIYGRNFCRSAKDAFNLLMRNVLKVAVTDEVTYFVLFLGKLLVAGSIGVLAFL    561 - 630
FFTQRLPVIAQGPASLNYYWVPLLTVIFGSYLIAHGFFSVYAMCVETIFICFLEDLERNDGSTARPYFVT    631 - 700
PNLHGILIKKQLVPQKQKE                                                       701 - 719
//

Text Mined References (10)

PMID Year Title