Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.14
PubTator Score 3.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 3.1205212549035E-24
psoriasis 6685 2.57274475166842E-20
pilocytic astrocytoma 3086 1.6428103636645E-11
oligodendroglioma 2849 2.62637225548882E-9
nasopharyngeal carcinoma 1056 5.78133536750078E-8
medulloblastoma 1524 6.40176905275575E-8
atypical teratoid / rhabdoid tumor 4369 3.23860122010805E-6
lung adenocarcinoma 2714 4.48107666107386E-5
medulloblastoma, large-cell 6234 5.03059912900621E-5
non-small cell lung cancer 2798 5.59942643619386E-4
pediatric high grade glioma 2712 5.96449464775362E-4
glioblastoma 5572 0.00468800406687249
astrocytic glioma 2241 0.00623556239077832
Endometriosis 535 0.022265572675335

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.500 0.006
glioblastoma -1.900 0.005
oligodendroglioma -1.400 0.000
posterior fossa group B ependymoma 4.700 0.000
medulloblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma, large-cell -2.600 0.000
non-small cell lung cancer -1.462 0.001
pediatric high grade glioma -1.700 0.001
pilocytic astrocytoma -2.700 0.000
lung adenocarcinoma -2.300 0.000
nasopharyngeal carcinoma -3.800 0.000
Endometriosis -1.866 0.022
psoriasis -1.100 0.000

Synonym

Accession Q8NCR6 Q5T598 Q5T599 Q5T5A0 Q8N9G4 Q96KD1 Q96LN1
Symbols CBE1
SMRP1
NYD-SP22
bA573M23.4

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
19213785 Chronological regulation of CBE1/Cbe1 expression during pulmonary differentiation suggests involvement in ciliogenesis, with an additional role during early lung development.
15242845 CBE1 may play an important role in the differentiation and/or function of ciliated cells in human airways

AA Sequence

MFLFSRKTRTPISTYSDSYRAPTSIKEVYKDPPLCAWEANKFLTPGLTHTMERHVDPEALQKMAKCAVQD      1 - 70
YTYRGSISGHPYLPEKYWLSQEEADKCSPNYLGSDWYNTWRMEPYNSSCCNKYTTYLPRLPKEARMETAV     71 - 140
RGMPLECPPRPERLNAYEREVMVNMLNSLSRNQQLPRITPRCGCVDPLPGRLPFHGYESACSGRHYCLRG    141 - 210
MDYYASGAPCTDRRLRPWCREQPTMCTSLRAPARNAVCCYNSPAVILPISEP                      211 - 262
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21630459 2011 Proteomic characterization of the human sperm nucleus.
19213785 2009 Chronological expression of Ciliated Bronchial Epithelium 1 during pulmonary development.
18163442 2008 Isolation and characterization of the spermatid-specific Smrp1 gene encoding a novel manchette protein.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15862967 2005 Yeast two-hybrid identification of prostatic proteins interacting with human sex hormone-binding globulin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15242845 2004 Characterization of ciliated bronchial epithelium 1, a ciliated cell-associated gene induced during mucociliary differentiation.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...