Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.14
PubTator Score 3.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.500 0.006
glioblastoma -1.900 0.005
oligodendroglioma -1.400 0.000
posterior fossa group B ependymoma 4.700 0.000
medulloblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma, large-cell -2.600 0.000
non-small cell lung cancer -1.462 0.001
pediatric high grade glioma -1.700 0.001
pilocytic astrocytoma -2.700 0.000
lung adenocarcinoma -2.300 0.000
nasopharyngeal carcinoma -3.800 0.000
Endometriosis -1.866 0.022
psoriasis -1.100 0.000

Synonym

Accession Q8NCR6 Q5T598 Q5T599 Q5T5A0 Q8N9G4 Q96KD1 Q96LN1
Symbols CBE1
SMRP1
NYD-SP22
bA573M23.4

Gene

Gene RIF (2)

PMID Text
19213785 Chronological regulation of CBE1/Cbe1 expression during pulmonary differentiation suggests involvement in ciliogenesis, with an additional role during early lung development.
15242845 CBE1 may play an important role in the differentiation and/or function of ciliated cells in human airways

AA Sequence

MFLFSRKTRTPISTYSDSYRAPTSIKEVYKDPPLCAWEANKFLTPGLTHTMERHVDPEALQKMAKCAVQD      1 - 70
YTYRGSISGHPYLPEKYWLSQEEADKCSPNYLGSDWYNTWRMEPYNSSCCNKYTTYLPRLPKEARMETAV     71 - 140
RGMPLECPPRPERLNAYEREVMVNMLNSLSRNQQLPRITPRCGCVDPLPGRLPFHGYESACSGRHYCLRG    141 - 210
MDYYASGAPCTDRRLRPWCREQPTMCTSLRAPARNAVCCYNSPAVILPISEP                      211 - 262
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21630459 2011 Proteomic characterization of the human sperm nucleus.
19213785 2009 Chronological expression of Ciliated Bronchial Epithelium 1 during pulmonary development.
18163442 2008 Isolation and characterization of the spermatid-specific Smrp1 gene encoding a novel manchette protein.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15862967 2005 Yeast two-hybrid identification of prostatic proteins interacting with human sex hormone-binding globulin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15242845 2004 Characterization of ciliated bronchial epithelium 1, a ciliated cell-associated gene induced during mucociliary differentiation.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...