Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.25
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Type 2 diabetes mellitus 189 2.0

Expression

Gene RIF (1)

PMID Text
19692168 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQIVKYINPKEAELLDAAAGIHV      1 - 70
RFRLGGVKFPPDIYYKIFTHRPIEDLCANSPRNYAKLPAKHTSHNKNDHLQEEDHSGWYHRIENNGWRPV     71 - 140
SDTFWLSTDGMVVEDKKESEFHFSKLKRRQDLEKKRKLRKIEWMRQMYYSGSLEAKSTHHETLGLIHTAT    141 - 210
KGLIRAFEDGGIDSVMEWEVDEVLNWTNTLNFDEYIASWKEIATSNSSANFKGFRFNQAQKNIYNYGGDI    211 - 280
SKMQMGIPDDTYYENVYQEPNVTRLTPDSTYGL                                         281 - 313
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21845381 2011 Does metformin work for everyone? A genome-wide association study for metformin response.
21186350 2011 Common variants near ATM are associated with glycemic response to metformin in type 2 diabetes.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...