Property Summary

NCBI Gene PubMed Count 9
Grant Count 1
Funding $77,072.6
PubMed Score 7.27
PubTator Score 5.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pituitary cancer -1.100 0.001

Synonym

Accession Q8NCR0 Q59GR3 Q5TCI3 Q96AL7 Beta-1,3-GalNAc-T2
Symbols MDDGA11
B3GalNAc-T2

Gene

PANTHER Protein Class (2)

 Grant Application (1)

Gene RIF (4)

PMID Text
24285400 B3GALNT2 overexpression is associated with breast cancer.
24084573 B3GALNT2 is a gene associated with congenital muscular dystrophy with brain malformations.
23453667 Results demonstrate a role for B3GALNT2 in the glycosylation of alpha-DG and show that B3GALNT2 mutations can cause dystroglycanopathy with muscle and brain involvement.
14724282 Although the GalNAcbeta1-3GlcNAcbeta1-R structure has not been reported in humans or other mammals, we have discovered a novel human glycosyltransferase producing this structure on N- and O-glycans.

AA Sequence

MRNWLVLLCPCVLGAALHLWLRLRSPPPACASGAGPADQLALFPQWKSTHYDVVVGVLSARNNHELRNVI      1 - 70
RSTWMRHLLQHPTLSQRVLVKFIIGAHGCEVPVEDREDPYSCKLLNITNPVLNQEIEAFSLSEDTSSGLP     71 - 140
EDRVVSVSFRVLYPIVITSLGVFYDANDVGFQRNITVKLYQAEQEEALFIARFSPPSCGVQVNKLWYKPV    141 - 210
EQFILPESFEGTIVWESQDLHGLVSRNLHKVTVNDGGGVLRVITAGEGALPHEFLEGVEGVAGGFIYTIQ    211 - 280
EGDALLHNLHSRPQRLIDHIRNLHEEDALLKEESSIYDDIVFVDVVDTYRNVPAKLLNFYRWTVETTSFN    281 - 350
LLLKTDDDCYIDLEAVFNRIVQKNLDGPNFWWGNFRLNWAVDRTGKWQELEYPSPAYPAFACGSGYVISK    351 - 420
DIVKWLASNSGRLKTYQGEDVSMGIWMAAIGPKRYQDSLWLCEKTCETGMLSSPQYSPWELTELWKLKER    421 - 490
CGDPCRCQAR                                                                491 - 500
//

Text Mined References (10)

PMID Year Title
24285400 2014 Involvement of B3GALNT2 overexpression in the cell growth of breast cancer.
24084573 2014 B3GALNT2 is a gene associated with congenital muscular dystrophy with brain malformations.
23929950 2013 SGK196 is a glycosylation-specific O-mannose kinase required for dystroglycan function.
23453667 2013 Mutations in B3GALNT2 cause congenital muscular dystrophy and hypoglycosylation of ?-dystroglycan.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14724282 2004 A novel human beta1,3-N-acetylgalactosaminyltransferase that synthesizes a unique carbohydrate structure, GalNAcbeta1-3GlcNAc.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.