Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.33
PubTator Score 1.70

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MWVRTTLTIERWTKEKTEPKARSWDESLSDVNRLPSWERGHLLAGVASSTDVSTFSEGGDCKEPDKCCWR      1 - 70
HKQCTGHIIYPFASDCVRHSLHLHSVNHCNCNSRLKDSSEDSSSSRGAGPTCSHVIESPCFELTPEEEHV     71 - 140
ERFRYGWCKSYRPVSVAVIHHPLYHECGADDLNEEEEEEEEESKPPIPTQVGPATASPDLGTSMATGTPD    141 - 210
STAPITIWRSESPTGKGQGSKVIKKVKKKKEKEKDKEEMDEKAKLKKKAKKGQLTKKKSPVKLEPSPPDV    211 - 280
SRSLSARQLARMSESSPESREELESEDSYNGRGQGELSSEDIVESSSPRKRENTVQAKKTGAKPSQARKV    281 - 350
NKRKSPPGSNPNLS                                                            351 - 364
//

Text Mined References (6)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15159402 2004 Identification of interaction partners and substrates of the cyclin A1-CDK2 complex.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.