Property Summary

NCBI Gene PubMed Count 16
PubMed Score 4.46
PubTator Score 1.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
nasopharyngeal carcinoma 1058 1.8e-07
ependymoma 4679 1.7e-04
chronic rhinosinusitis 512 2.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Invasive aspergillosis 6 3.112 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
chronic rhinosinusitis -1.800 2.7e-02
ependymoma 1.400 1.7e-04
nasopharyngeal carcinoma -1.800 1.8e-07

Synonym

Accession Q8NCQ5 B3KST3
Symbols FBX15

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

Protein-protein Interaction (3)

Gene RIF (1)

AA Sequence

MATGRGRILQQHWLGLQTLRGPSRGGGAARGRARAFGCRKGPGVKLSAGSAALRCHAGGGQHWESSFSCC      1 - 70
SGFLDGMPSEILLKIFSYLDAVSLLCTGCVSRRFYHLANDNFIWIGIYSTAFSPARSNWKFNSVEKIAMS     71 - 140
MSFLSVQDKEAGYWKKEYITKQIASVKAALADILKPVNPYTGLPVKTKEALRIFGLGWAIILKEKGGKEY    141 - 210
IMEHVDLSINDTSVTVIWYGKKWPCLASLSTLDLCGMTPVFTDWYKTPTKHRLRWHSLIAKYNLSHLTIS    211 - 280
TMIGCDRLIRIFCLHPGLLVGVWKKEEELAFVMANLHFHHLVERSTLGSATIPYELPPHSPFLDDSPEYG    281 - 350
LHGYQLHVDLHSGGVFYLCGTFRNLFTKRGNIENGHVKLIVIHLKNNREHLPLIGKVGLSWKTDIFDGCI    351 - 420
KSCSMMDVTLLDEHGKPFWCFSSPVCLRSPATPSDSSSFLGQTYNVDYVDAEGRVHVELVWIRETEEYLI    421 - 490
VNLVLYLSIAKINHWFGTEY                                                      491 - 510
//

Text Mined References (16)

PMID Year Title