Property Summary

NCBI Gene PubMed Count 15
Grant Count 5
R01 Count 5
Funding $199,807.5
PubMed Score 3.76
PubTator Score 1.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
posterior fossa group B ependymoma 2.700 0.000
nasopharyngeal carcinoma -1.800 0.000
chronic rhinosinusitis -1.800 0.027

Gene RIF (1)

PMID Text
23465077 These data suggest that FBXO15 and Ube2r1 regulate P-gp expression through the ubiquitin-proteasome pathway.

AA Sequence

MATGRGRILQQHWLGLQTLRGPSRGGGAARGRARAFGCRKGPGVKLSAGSAALRCHAGGGQHWESSFSCC      1 - 70
SGFLDGMPSEILLKIFSYLDAVSLLCTGCVSRRFYHLANDNFIWIGIYSTAFSPARSNWKFNSVEKIAMS     71 - 140
MSFLSVQDKEAGYWKKEYITKQIASVKAALADILKPVNPYTGLPVKTKEALRIFGLGWAIILKEKGGKEY    141 - 210
IMEHVDLSINDTSVTVIWYGKKWPCLASLSTLDLCGMTPVFTDWYKTPTKHRLRWHSLIAKYNLSHLTIS    211 - 280
TMIGCDRLIRIFCLHPGLLVGVWKKEEELAFVMANLHFHHLVERSTLGSATIPYELPPHSPFLDDSPEYG    281 - 350
LHGYQLHVDLHSGGVFYLCGTFRNLFTKRGNIENGHVKLIVIHLKNNREHLPLIGKVGLSWKTDIFDGCI    351 - 420
KSCSMMDVTLLDEHGKPFWCFSSPVCLRSPATPSDSSSFLGQTYNVDYVDAEGRVHVELVWIRETEEYLI    421 - 490
VNLVLYLSIAKINHWFGTEY                                                      491 - 510
//

Text Mined References (15)

PMID Year Title
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
24376456 2013 Gene-alcohol interactions identify several novel blood pressure loci including a promising locus near SLC16A9.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23728906 2013 A genome-wide association study of sleep habits and insomnia.
23509962 2013 A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.
23465077 2013 FBXO15 regulates P-glycoprotein/ABCB1 expression through the ubiquitin--proteasome pathway in cancer cells.
23408906 2013 A meta-analysis of thyroid-related traits reveals novel loci and gender-specific differences in the regulation of thyroid function.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...