Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

 Compartment GO Term (0)

 GWAS Trait (1)

AA Sequence

MPSSHIVLKEETRMLGLMYAIWMNLNSFGLAIIGILLIACEIILFLTKDETIQWPHVPSNRGSKANLILK      1 - 70
ELQLLVRSTWWFHRETAQRTCLYLA                                                  71 - 95
//

Text Mined References (2)

PMID Year Title