Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

Synonym

Accession Q8NCQ2
Symbols C19orf34

 Compartment GO Term (0)

AA Sequence

MGRAGPRSTADTRPRATVITTRRPRPWQKPTSPRRLHRRRPRGQPASENAAEPSQVAISKGKSPDYANGG      1 - 70
KAAMDSRASDAINKSKVDTSASNPSQRRPSRLRGKRSLALPPRLECLFPSSCGSRRATSRPGFPPLEGSH     71 - 140
LGCQLLPL                                                                  141 - 148
//

Text Mined References (5)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.