Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 2.1e-06

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.272 2.1e-06

Synonym

Accession Q8NCQ2
Symbols C19orf34

 Compartment GO Term (0)

AA Sequence

MGRAGPRSTADTRPRATVITTRRPRPWQKPTSPRRLHRRRPRGQPASENAAEPSQVAISKGKSPDYANGG      1 - 70
KAAMDSRASDAINKSKVDTSASNPSQRRPSRLRGKRSLALPPRLECLFPSSCGSRRATSRPGFPPLEGSH     71 - 140
LGCQLLPL                                                                  141 - 148
//

Text Mined References (5)

PMID Year Title