Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.29
PubTator Score 0.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.100 3.5e-03
atypical teratoid / rhabdoid tumor -1.200 2.2e-04
Breast cancer -1.300 1.4e-11
breast carcinoma -1.100 2.8e-24
colon cancer -1.100 3.9e-02
Duchenne muscular dystrophy -1.006 2.7e-05
glioblastoma -1.300 7.9e-05
hepatocellular carcinoma -1.100 1.1e-03
invasive ductal carcinoma -1.100 3.0e-03
limb girdle muscular dystrophy 2B -1.178 1.2e-03
malignant mesothelioma 1.500 2.1e-05
ovarian cancer -2.300 1.6e-05
tuberculosis -1.200 1.6e-04

AA Sequence

MGVKTFTHSSSSHSQEMLGKLNMLRNDGHFCDITIRVQDKIFRAHKVVLAACSDFFRTKLVGQAEDENKN      1 - 70
VLDLHHVTVTGFIPLLEYAYTATLSINTENIIDVLAAASYMQMFSVASTCSEFMKSSILWNTPNSQPEKG     71 - 140
LDAGQENNSNCNFTSRDGSISPVSSECSVVERTIPVCRESRRKRKSYIVMSPESPVKCGTQTSSPQVLNS    141 - 210
SASYSENRNQPVDSSLAFPWTFPFGIDRRIQPEKVKQAENTRTLELPGPSETGRRMADYVTCESTKTTLP    211 - 280
LGTEEDVRVKVERLSDEEVHEEVSQPVSASQSSLSDQQTVPGSEQVQEDLLISPQSSSIGSVDEGVSEGL    281 - 350
PTLQSTSSTNAPPDDDDRLENVQYPYQLYIAPSTSSTERPSPNGPDRPFQCPTCGVRFTRIQNLKQHMLI    351 - 420
HSGIKPFQCDRCGKKFTRAYSLKMHRLKHEGKRCFRCQICSATFTSFGEYKHHMRVSRHIIRKPRIYECK    421 - 490
TCGAMLTNSGNLIVHLRSLNHEASELANYFQSSDFLVPDYLNQEQEETLVQYDLGEHGFESNSSVQMPVI    491 - 560
SQYHSKGKEP                                                                561 - 570
//

Text Mined References (16)

PMID Year Title