Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.21
PubTator Score 0.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
hepatocellular carcinoma -1.100 0.001
malignant mesothelioma 1.500 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
glioblastoma -1.500 0.000
Duchenne muscular dystrophy -1.006 0.000
limb girdle muscular dystrophy 2B -1.178 0.001
tuberculosis -1.200 0.000
colon cancer -1.100 0.039
adult high grade glioma -1.200 0.000
breast carcinoma -1.100 0.000
Breast cancer -1.300 0.000
invasive ductal carcinoma -1.100 0.003
ovarian cancer -2.300 0.000

AA Sequence

MGVKTFTHSSSSHSQEMLGKLNMLRNDGHFCDITIRVQDKIFRAHKVVLAACSDFFRTKLVGQAEDENKN      1 - 70
VLDLHHVTVTGFIPLLEYAYTATLSINTENIIDVLAAASYMQMFSVASTCSEFMKSSILWNTPNSQPEKG     71 - 140
LDAGQENNSNCNFTSRDGSISPVSSECSVVERTIPVCRESRRKRKSYIVMSPESPVKCGTQTSSPQVLNS    141 - 210
SASYSENRNQPVDSSLAFPWTFPFGIDRRIQPEKVKQAENTRTLELPGPSETGRRMADYVTCESTKTTLP    211 - 280
LGTEEDVRVKVERLSDEEVHEEVSQPVSASQSSLSDQQTVPGSEQVQEDLLISPQSSSIGSVDEGVSEGL    281 - 350
PTLQSTSSTNAPPDDDDRLENVQYPYQLYIAPSTSSTERPSPNGPDRPFQCPTCGVRFTRIQNLKQHMLI    351 - 420
HSGIKPFQCDRCGKKFTRAYSLKMHRLKHEGKRCFRCQICSATFTSFGEYKHHMRVSRHIIRKPRIYECK    421 - 490
TCGAMLTNSGNLIVHLRSLNHEASELANYFQSSDFLVPDYLNQEQEETLVQYDLGEHGFESNSSVQMPVI    491 - 560
SQYHSKGKEP                                                                561 - 570
//

Text Mined References (15)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
More...