Property Summary

NCBI Gene PubMed Count 26
PubMed Score 38.19
PubTator Score 29.42

Knowledge Summary


No data available


  Disease Sources (6)



Accession Q8NCM8 O00432 Q16693 Q3C1U8 Q4AC93 Q6ZMX7 Q6ZUM6 Q7Z363 Q8N977 Q92815 Q9HAE4
Symbols ATD3




  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA Inparanoid

 CSPA Cell Line (1)

Gene RIF (14)

26147384 Gene-based association analyses shows nominal significant association with multifocal fibromuscular dysplasia for cynein cytoplasmic heavy chain 1.
25982780 a DYNC2H1 mutations causing SRPS III
25502651 Dynein heavy chain knockdown by siRNA enhances HIV-1 infectivity in TRIMCyp-expressing HeLa cells but not in TRIMCyp-expressing owl monkey cells
25410398 Compound heterozygous mutation in DYNC2H1 gene is associated with severe short-rib polydactyly syndrome type III.
25375884 HIV-1 CA uncoating is delayed in the presence of ciliobrevin D, a specific inhibitor of dynein-mediated motor function, indicating that dynein is involved in CA uncoating in cells
25231297 HIV-1 CA uncoating is delayed in the presence of ciliobrevin D, a specific inhibitor of dynein-mediated motor function, indicating that dynein is involved in CA uncoating in cells
24046448 Partial depletion of giantin or of WDR34 leads to an increase in cilia length consistent with the concept that giantin acts through dynein-2.
23456818 Exome sequencing identifies DYNC2H1 mutations as a common cause of asphyxiating thoracic dystrophy (Jeune syndrome) without major polydactyly, renal or retinal involvement.
22499340 This study confirms that NEK1 is one gene causing SRP type II but also reports mutations in DYNC2H1, expanding the phenotypic spectrum of DYNC2H1 mutations.
21723285 In an in vitro MT gliding assay, both dynein-1 and dynein-2 showed minus-end-directed motor activities.

AA Sequence

VYTSAERDRVVTNIDVPCGGNQDQWIQCGAALFLKNQ                                    4271 - 4307

Text Mined References (30)

PMID Year Title
26147384 2015 Exome sequencing in seven families and gene-based association studies indicate genetic heterogeneity and suggest possible candidates for fibromuscular dysplasia.
25982780 2015 Targeted next-generation sequencing identifies novel compound heterozygous mutations of DYNC2H1 in a fetus with short rib-polydactyly syndrome, type III.
25410398 2015 Novel compound heterozygous mutations in DYNC2H1 in a patient with severe short-rib polydactyly syndrome type III phenotype.
25343990 2015 Genome-wide association study of selenium concentrations.
24057671 2014 Genome-wide association study of ancestry-specific TB risk in the South African Coloured population.
24046448 2013 A role for the Golgi matrix protein giantin in ciliogenesis through control of the localization of dynein-2.
23456818 2013 Exome sequencing identifies DYNC2H1 mutations as a common cause of asphyxiating thoracic dystrophy (Jeune syndrome) without major polydactyly, renal or retinal involvement.
22499340 2012 NEK1 and DYNC2H1 are both involved in short rib polydactyly Majewski type but not in Beemer Langer cases.
21723285 2011 Recombinant human cytoplasmic dynein heavy chain 1 and 2: observation of dynein-2 motor activity in vitro.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.