Transmembrane protein 116

Property Summary

NCBI Gene PubMed Count	4
PubMed Score	0.10

PubTator Score	0.10

Knowledge Summary

Patent

No data available

TINX Plot

Disease (1)

Expression Atlas

Disease	Target Count	P-value
psoriasis	6694	4.2e-33
tuberculosis	2010	1.2e-06
interstitial cystitis	2312	3.8e-05
osteosarcoma	7950	5.9e-05
gastric carcinoma	807	1.8e-02

Expression

Specificity
Differential

Differential Expression (5)

Disease	log2 FC	p
gastric carcinoma	-1.400	1.8e-02
interstitial cystitis	-1.200	3.8e-05
osteosarcoma	-1.198	5.9e-05
psoriasis	-1.300	4.2e-33
tuberculosis	1.200	1.2e-06

Testis 18,518

Skin - Sun Exposed (Lower leg) 17,968

Skin - Not Sun Exposed (Suprapubic) 18,081

Ovary 17,971

Nerve - Tibial 18,007

Thyroid 18,024

Uterus 17,618

Kidney - Cortex 17,329

Artery - Coronary 17,949

Pituitary 18,147

Brain - Spinal cord (cervical c-1) 17,973

Vagina 17,834

Brain - Cerebellar Hemisphere 18,015

Brain - Cerebellum 17,983

Small Intestine - Terminal Ileum 17,954

Artery - Tibial 17,631

Artery - Aorta 17,896

Stomach 17,879

Cells - EBV-transformed lymphocytes 18,186

Minor Salivary Gland 18,005

Heart - Left Ventricle 18,006

Adipose - Subcutaneous 18,110

Cells - Transformed fibroblasts 17,577

Spleen 17,614

Breast - Mammary Tissue 18,103

Adipose - Visceral (Omentum) 17,937

Brain - Nucleus accumbens (basal ganglia... 18,024

Adrenal Gland 18,071

Lung 18,057

Prostate 18,213

Heart - Atrial Appendage 17,896

Brain - Substantia nigra 17,981

Colon - Sigmoid 18,089

Brain - Caudate (basal ganglia) 18,001

Esophagus - Gastroesophageal Junction 18,000

Brain - Hypothalamus 18,169

Esophagus - Muscularis 18,017

Brain - Frontal Cortex (BA9) 18,069

Esophagus - Mucosa 18,076

Brain - Putamen (basal ganglia) 17,863

Brain - Cortex 18,039

Brain - Amygdala 18,006

Brain - Anterior cingulate cortex (BA24) 17,989

Brain - Hippocampus 18,011

Liver 18,071

Muscle - Skeletal 17,778

Colon - Transverse 17,825

Whole Blood 17,439

Pancreas 18,123

adipose tissue 15,837

adrenal gland 15,963

appendix 16,247

bone marrow 14,571

breast 16,063

cerebral cortex 16,630

cervix, uterine 15,871

colon 15,959

duodenum 15,975

endometrium 16,349

epididymis 15,863

esophagus 15,898

fallopian tube 16,245

gallbladder 16,333

heart muscle 14,972

kidney 15,917

liver 14,587

lung 16,312

lymph node 15,833

ovary 15,408

pancreas 14,070

parathyroid gland 14,769

placenta 15,937

prostate 16,460

rectum 15,705

salivary gland 14,981

seminal vesicle 15,918

skeletal muscle 14,011

skin 16,206

small intestine 16,154

smooth muscle 15,857

spleen 15,972

stomach 16,099

testis 17,936

thyroid gland 15,959

tonsil 15,400

urinary bladder 15,814

Liver and Pancreas 16,750

Digestive Tract 17,369

Urinary Tract 16,678

Endocrine System 18,159

Blood and immune system 16,909

Respiratory system 16,393

Female tissues 17,400

Male tissues 17,142

Skin and soft tissues 17,230

Nervous System 16,725

Cardiovascular System 15,192

Brain 7,346

Lung 2,286

Mammary gland 415

Synonym

Accession	Q8NCL8 G3V1W7 G5E985 Q6NSH5 Q8IZ66
Symbols

Gene

TMEM116

Ortholog (10)

Species	Source	Disease
Zebrafish 9,726	Inparanoid OMA EggNOG
Mouse 16,570	Inparanoid OMA
Horse 14,252	Inparanoid OMA EggNOG
Cow 15,320	Inparanoid OMA EggNOG
Rat 15,117	Inparanoid OMA
Dog 15,073	Inparanoid OMA EggNOG
Anole lizard 10,588	Inparanoid OMA
Xenopus 10,468	OMA EggNOG
Opossum 12,230	Inparanoid OMA EggNOG
Chicken 7,827	OMA EggNOG

UniProt Keyword (7)

Complete proteome 20,231

Polymorphism 12,194

Reference proteome 20,231

Alternative splicing 10,528

Membrane 7,361

Transmembrane 5,228

Transmembrane helix 5,207

GO Component (1)

integral component of membrane 3,665

Compartment GO Term (7)

Integral component of membrane 5,331

Intrinsic component of membrane 5,458

Membrane 8,531

Membrane part 6,554

Microtubules 233

Nucleoplasm 5,077

cellular_component 18,320

IMPC Phenotype (3)

improved glucose tolerance 79

decreased circulating alkaline phosphata... 46

decreased circulating total protein leve... 49

GWAS Trait (1)

Platelet count 275

HCA RNA Cell Line (56)

A-431 16,131

A549 15,174

AF22 16,160

AN3-CA 15,648

ASC TERT1 14,842

BEWO 16,726

BJ 15,448

BJ hTERT+ 15,353

BJ hTERT+ SV40 Large T+ 15,609

BJ hTERT+ SV40 Large T+ RasG12V 15,493

See all...

AA Sequence

MKHTQSGQSTSPLVIDYTCRVCQMAFVFSSLIPLLLMTPVFCLGNTSECFQNFSQSHKCILMHSPPSAMA      1 - 70
ELPPSANTSVCSTLYFYGIAIFLGSFVLSLLTIMVLLIRAQTLYKKFVKSTGFLGSEQWAVIHIVDQRVR     71 - 140
FYPVAFFCCWGPAVILMIIKLTKPQDTKLHMALYVLQALTATSQGLLNCGVYGWTQHKFHQLKQEARRDA    141 - 210
DTQTPLLCSQKRFYSRGLNSLESTLTFPASTSTIF                                       211 - 245
//

Text Mined References (5)

Summary
Details

	PMID	Year	Title