Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.10
PubTator Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 4.1807900298151E-10
tuberculosis 1563 1.19670115341061E-6
interstitial cystitis 2299 3.84017961491143E-5
osteosarcoma 7933 5.94987685986091E-5
gastric carcinoma 832 0.0180010311096519

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.198 0.000
tuberculosis 1.200 0.000
interstitial cystitis -1.200 0.000
psoriasis -1.400 0.000
gastric carcinoma -1.400 0.018

Synonym

Accession Q8NCL8 G3V1W7 G5E985 Q6NSH5 Q8IZ66
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG

AA Sequence

MKHTQSGQSTSPLVIDYTCRVCQMAFVFSSLIPLLLMTPVFCLGNTSECFQNFSQSHKCILMHSPPSAMA      1 - 70
ELPPSANTSVCSTLYFYGIAIFLGSFVLSLLTIMVLLIRAQTLYKKFVKSTGFLGSEQWAVIHIVDQRVR     71 - 140
FYPVAFFCCWGPAVILMIIKLTKPQDTKLHMALYVLQALTATSQGLLNCGVYGWTQHKFHQLKQEARRDA    141 - 210
DTQTPLLCSQKRFYSRGLNSLESTLTFPASTSTIF                                       211 - 245
//

Text Mined References (5)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.