Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.10
PubTator Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 4.2e-33
tuberculosis 2010 1.2e-06
interstitial cystitis 2312 3.8e-05
osteosarcoma 7950 5.9e-05
gastric carcinoma 807 1.8e-02

Expression

  Differential Expression (5)

Disease log2 FC p
gastric carcinoma -1.400 1.8e-02
interstitial cystitis -1.200 3.8e-05
osteosarcoma -1.198 5.9e-05
psoriasis -1.300 4.2e-33
tuberculosis 1.200 1.2e-06

AA Sequence

MKHTQSGQSTSPLVIDYTCRVCQMAFVFSSLIPLLLMTPVFCLGNTSECFQNFSQSHKCILMHSPPSAMA      1 - 70
ELPPSANTSVCSTLYFYGIAIFLGSFVLSLLTIMVLLIRAQTLYKKFVKSTGFLGSEQWAVIHIVDQRVR     71 - 140
FYPVAFFCCWGPAVILMIIKLTKPQDTKLHMALYVLQALTATSQGLLNCGVYGWTQHKFHQLKQEARRDA    141 - 210
DTQTPLLCSQKRFYSRGLNSLESTLTFPASTSTIF                                       211 - 245
//

Text Mined References (5)

PMID Year Title