Property Summary

NCBI Gene PubMed Count 6
PubMed Score 5.45
PubTator Score 6.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 0.000

Synonym

Accession Q8NCK7 MCT 11
Symbols MCT11

Gene

PANTHER Protein Class (1)

Gene RIF (3)

PMID Text
26487785 Our study identified an association between the SLC16A11 variant rs75493593 and type 2 diabetes in American Indians, where the effect on diabetes was much more pronounced in nonobese individuals. rs75493593 was also associated with RNASEK gene expression.
25839936 Genetic association studies show that common variants in ABCA1 and SLC16A11 are involved in type 2 diabetes (T2D) susceptibility. Particularly, the variants rs10811661 (CDKN2A/2B) and rs9282541 (ABCA1) are associated with T2D in adult Maya population.
24390345 Despite type 2 diabetes having been well studied by GWAS in other populations, analysis in Mexican and Latin American individuals identified SLC16A11 as a novel candidate gene for type 2 diabetes with a possible role in triacylglycerol metabolism.

AA Sequence

MPAPQRKHRRGGFSHRCFPTPQTAMTPQPAGPPDGGWGWVVAAAAFAINGLSYGLLRSLGLAFPDLAEHF      1 - 70
DRSAQDTAWISALALAVQQAASPVGSALSTRWGARPVVMVGGVLASLGFVFSAFASDLLHLYLGLGLLAG     71 - 140
FGWALVFAPALGTLSRYFSRRRVLAVGLALTGNGASSLLLAPALQLLLDTFGWRGALLLLGAITLHLTPC    141 - 210
GALLLPLVLPGDPPAPPRSPLAALGLSLFTRRAFSIFALGTALVGGGYFVPYVHLAPHALDRGLGGYGAA    211 - 280
LVVAVAAMGDAGARLVCGWLADQGWVPLPRLLAVFGALTGLGLWVVGLVPVVGGEESWGGPLLAAAVAYG    281 - 350
LSAGSYAPLVFGVLPGLVGVGGVVQATGLVMMLMSLGGLLGPPLSGFLRDETGDFTASFLLSGSLILSGS    351 - 420
FIYIGLPRALPSCGPASPPATPPPETGELLPAPQAVLLSPGGPGSTLDTTC                       421 - 471
//

Text Mined References (8)

PMID Year Title
26487785 2016 Analysis of SLC16A11 Variants in 12,811 American Indians: Genotype-Obesity Interaction for Type 2 Diabetes and an Association With RNASEK Expression.
25839936 2015 Diabetes susceptibility in Mayas: Evidence for the involvement of polymorphisms in HHEX, HNF4?, KCNJ11, PPAR?, CDKN2A/2B, SLC30A8, CDC123/CAMK1D, TCF7L2, ABCA1 and SLC16A11 genes.
24390345 2014 Sequence variants in SLC16A11 are a common risk factor for type 2 diabetes in Mexico.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12739169 2004 The SLC16 gene family-from monocarboxylate transporters (MCTs) to aromatic amino acid transporters and beyond.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.