Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 4.1509038980093E-14
psoriasis 6685 5.47218272294891E-11
ovarian cancer 8492 8.57063625921253E-11
non-small cell lung carcinoma 413 1.44182552401042E-7
lung adenocarcinoma 2714 4.21735933184714E-7
medulloblastoma, large-cell 6234 2.07978602669071E-4
Atopic dermatitis 944 6.06375454867603E-4
adult high grade glioma 2148 0.00253165383656953
Disease Target Count Z-score Confidence
Leber congenital amaurosis 72 3.255 1.6

Expression

  Differential Expression (8)

Disease log2 FC p
medulloblastoma, large-cell 1.200 0.000
Atopic dermatitis 1.100 0.001
lung adenocarcinoma 1.800 0.000
adult high grade glioma 1.100 0.003
psoriasis 1.600 0.000
lung carcinoma 1.100 0.000
non-small cell lung carcinoma 1.400 0.000
ovarian cancer 1.200 0.000

Synonym

Accession Q8NCI6 A6NEM0 A6NN15 Q6P3S3 Q96FF8
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MKSPPLLSPCLSWKRMAGIFFLPFISSGFAPRFKQEENFMLGRAHPSQPRFNWSHLTPLELKNRSVGLGT      1 - 70
ESTGRGKPHFTLEGHKFLIFGGSIHYFRVPREYWRDRLLKLKACGFNTVTTYVPWNLHEPERGKFDFSGN     71 - 140
LDLEAFVLMAAEIGLWVILRPGRYICSEMDLGGLPSWLLQDPRLLLRTTNKSFIEAVEKYFDHLIPRVIP    141 - 210
LQYRQAGPVIAVQVENEYGSFNKDKTYMPYLHKALLRRGIVELLLTSDGEKHVLSGHTKGVLAAINLQKL    211 - 280
HQDTFNQLHKVQRDKPLLIMEYWVGWFDRWGDKHHVKDAKEVEHAVSEFIKYEISFNVYMFHGGTNFGFM    281 - 350
NGATYFGKHSGIVTSYDYDAVLTEAGDYTEKYLKLQKLFQSVSATPLPRVPKLPPKAVYPPVRPSLYLPL    351 - 420
WDALSYLNEPVRSRQPVNMENLPINNGSGQSYGLVLYEKSICSGGRLRAHAHDVAQVFLDETMIGILNEN    421 - 490
NKDLHIPELRDCRYLRILVENQGRVNFSWQIQNEQKGITGSVSINNSSLEGFTIYSLEMKMSFFERLRSA    491 - 560
TWKPVPDSHQGPAFYCGTLKAGPSPKDTFLSLLNWNYGFVFINGRNLGRYWNIGPQKTLYLPGVWLHPED    561 - 630
NEVILFEKMMSGSDIKSTDKPTL                                                   631 - 653
//

Text Mined References (6)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.