Property Summary

NCBI Gene PubMed Count 18
PubMed Score 185.35
PubTator Score 21.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 1.400 2.0e-04
Astrocytoma, Pilocytic 1.800 4.0e-09
atypical teratoid / rhabdoid tumor 2.200 2.9e-10
ependymoma 1.600 1.9e-15
glioblastoma 1.600 2.1e-09
group 3 medulloblastoma 1.800 8.8e-05
medulloblastoma, large-cell 1.300 2.4e-03
ovarian cancer 1.100 3.7e-05
primitive neuroectodermal tumor 1.900 5.2e-06

Protein-protein Interaction (4)

Gene RIF (12)

AA Sequence

MFPRPLTPLAAPNGAEPLGRALRRAPLGRARAGLGGPPLLLPSMLMFAVIVASSGLLLMIERGILAEMKP      1 - 70
LPLHPPGREGTAWRGKAPKPGGLSLRAGDADLQVRQDVRNRTLRAVCGQPGMPRDPWDLPVGQRRTLLRH     71 - 140
ILVSDRYRFLYCYVPKVACSNWKRVMKVLAGVLDSVDVRLKMDHRSDLVFLADLRPEEIRYRLQHYFKFL    141 - 210
FVREPLERLLSAYRNKFGEIREYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWM    211 - 280
PVYHLCQPCAVHYDFVGSYERLEADANQVLEWVRAPPHVRFPARQAWYRPASPESLHYHLCSAPRALLQD    281 - 350
VLPKYILDFSLFAYPLPNVTKEACQQ                                                351 - 376
//

Text Mined References (18)

PMID Year Title