Property Summary

NCBI Gene PubMed Count 11
PubMed Score 15.60
PubTator Score 4.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Obesity 616
Disease Target Count P-value
medulloblastoma, large-cell 6234 7.66920153684422E-6
osteosarcoma 7933 1.35318464786196E-4
primary pancreatic ductal adenocarcinoma 1271 0.00387438580480554
aldosterone-producing adenoma 664 0.0219203979655778
gastric carcinoma 832 0.0378717858635052
Disease Target Count Z-score Confidence
Cannabis dependence 18 4.342 2.2

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.878 0.000
medulloblastoma, large-cell -1.100 0.000
primary pancreatic ductal adenocarcinoma 1.165 0.004
aldosterone-producing adenoma -1.060 0.022
gastric carcinoma 1.300 0.038

Synonym

Accession Q8NCG7 A4D2P3 B3KV90 B4DQU0 Q6PIX3 Q8N2N2 Q8N9S1 Q8TED3 Q8WXE6 DGL-beta
Symbols KCCR13L
DAGLBETA

Gene

  Ortholog (11)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

 GWAS Trait (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
504411 screening 203 / 0 / 343497 Fluorescence-based primary biochemical high throughput screening assay to identify inhibitors of human diacylglycerol lipase, beta (DAGLB)
504445 screening 141 / 0 / 51 Fluorescence-based biochemical high throughput confirmation assay for inhibitors of human diacylglycerol lipase, beta (DAGLB)

Gene RIF (2)

PMID Text
22190034 HIV-1 Vpu is identified to have a physical interaction with diacylglycerol lipase, beta (DAGLB) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14610053 This gene has been functionally characterized as a diacylglycerol-lipase (DAGL), referred to as DAGL beta. These enzymes may have a role in the biosynthesis of the endocannabinoid 2-arachidnoyl glycerol (2-AG).

AA Sequence

MPGMVLFGRRWAIASDDLVFPGFFELVVRVLWWIGILTLYLMHRGKLDCAGGALLSSYLIVLMILLAVVI      1 - 70
CTVSAIMCVSMRGTICNPGPRKSMSKLLYIRLALFFPEMVWASLGAAWVADGVQCDRTVVNGIIATVVVS     71 - 140
WIIIAATVVSIIIVFDPLGGKMAPYSSAGPSHLDSHDSSQLLNGLKTAATSVWETRIKLLCCCIGKDDHT    141 - 210
RVAFSSTAELFSTYFSDTDLVPSDIAAGLALLHQQQDNIRNNQEPAQVVCHAPGSSQEADLDAELENCHH    211 - 280
YMQFAAAAYGWPLYIYRNPLTGLCRIGGDCCRSRTTDYDLVGGDQLNCHFGSILHTTGLQYRDFIHVSFH    281 - 350
DKVYELPFLVALDHRKESVVVAVRGTMSLQDVLTDLSAESEVLDVECEVQDRLAHKGISQAARYVYQRLI    351 - 420
NDGILSQAFSIAPEYRLVIVGHSLGGGAAALLATMLRAAYPQVRCYAFSPPRGLWSKALQEYSQSFIVSL    421 - 490
VLGKDVIPRLSVTNLEDLKRRILRVVAHCNKPKYKILLHGLWYELFGGNPNNLPTELDGGDQEVLTQPLL    491 - 560
GEQSLLTRWSPAYSFSSDSPLDSSPKYPPLYPPGRIIHLQEEGASGRFGCCSAAHYSAKWSHEAEFSKIL    561 - 630
IGPKMLTDHMPDILMRALDSVVSDRAACVSCPAQGVSSVDVA                                631 - 672
//

Text Mined References (19)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17897319 2007 Integral and associated lysosomal membrane proteins.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
More...