Property Summary

NCBI Gene PubMed Count 19
PubMed Score 23.68
PubTator Score 18.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
pituitary cancer 1972 2.31780021722352E-7
psoriasis 6685 2.18350071722323E-5
osteosarcoma 7933 6.35027251525288E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 7.242340974745E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0138517515431138
Disease Target Count Z-score Confidence
Liver neoplasm 7 3.199 1.6
Mucinous Adenocarcinoma 4 3.117 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.150 0.000
intraductal papillary-mucinous adenoma (... -2.600 0.001
intraductal papillary-mucinous carcinoma... -2.100 0.014
pituitary cancer 1.900 0.000
psoriasis 1.600 0.000

Synonym

Accession Q8NCG5 Q8IV46 Q9Y5R3
Symbols GST3
LSST
GlcNAc6ST2
HECGLCNAC6ST

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Chicken OMA EggNOG Inparanoid

Gene RIF (8)

PMID Text
24799377 A method for O-GlcNAc detection using in vitro sulfation with two N-acetylglucosamine (GlcNAc)-specific sulfotransferases, carbohydrate sulfotransferase 2 and carbohydrate sulfotransferase 4.
19343046 Observational study of gene-disease association. (HuGE Navigator)
19156517 GlcNAc6ST2 could therefore be a good serological marker for detecting early-stage uterine cervical and corpus cancers.
16386360 N-acetylgluosamine-6-O-sulfotransferase is overexpressed in a subgroup of paediatric precursor-B acute lymphoblastic leukaemia
12218059 involved in enzymatic synthesis in vitro of the disulfated disaccharide unit of corneal keratan sulfate
12107080 Ectopic expression of a GlcNAc 6-O-sulfotransferase, GlcNAc6ST-2, in colonic mucinous adenocarcinoma
8419650 Sulfate is linked to the carbohydrate chains of HIV-1 glycoproteins gp160, gp120, and gp41 during the endoplasmic reticulum to Golgi transport of the glycoproteins
1433500 Sulfate is linked to the carbohydrate chains of HIV-1 glycoproteins gp160, gp120, and gp41 during the endoplasmic reticulum to Golgi transport of the glycoproteins

AA Sequence

MLLPKKMKLLLFLVSQMAILALFFHMYSHNISSLSMKAQPERMHVLVLSSWRSGSSFVGQLFGQHPDVFY      1 - 70
LMEPAWHVWMTFKQSTAWMLHMAVRDLIRAVFLCDMSVFDAYMEPGPRRQSSLFQWENSRALCSAPACDI     71 - 140
IPQDEIIPRAHCRLLCSQQPFEVVEKACRSYSHVVLKEVRFFNLQSLYPLLKDPSLNLHIVHLVRDPRAV    141 - 210
FRSRERTKGDLMIDSRIVMGQHEQKLKKEDQPYYVMQVICQSQLEIYKTIQSLPKALQERYLLVRYEDLA    211 - 280
RAPVAQTSRMYEFVGLEFLPHLQTWVHNITRGKGMGDHAFHTNARDALNVSQAWRWSLPYEKVSRLQKAC    281 - 350
GDAMNLLGYRHVRSEQEQRNLLLDLLSTWTVPEQIH                                      351 - 386
//

Text Mined References (19)

PMID Year Title
24799377 2014 Detecting O-GlcNAc using in vitro sulfation.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19156517 2009 N-Acetylglucosamine 6-O-sulfotransferase-2 as a tumor marker for uterine cervical and corpus cancer.
17049924 2006 Sulfated L-selectin ligands as a therapeutic target in chronic inflammation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15752429 2005 A HEV-restricted sulfotransferase is expressed in rheumatoid arthritis synovium and is induced by lymphotoxin-alpha/beta and TNF-alpha in cultured endothelial cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15220337 2004 The stem region of the sulfotransferase GlcNAc6ST-1 is a determinant of substrate specificity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...