Property Summary

NCBI Gene PubMed Count 20
PubMed Score 24.87
PubTator Score 18.41

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... -2.600 7.2e-04
intraductal papillary-mucinous carcinoma... -2.100 1.4e-02
osteosarcoma 1.150 6.4e-05
pituitary cancer 1.900 2.3e-07
psoriasis 1.600 2.2e-05

Gene RIF (9)

AA Sequence

MLLPKKMKLLLFLVSQMAILALFFHMYSHNISSLSMKAQPERMHVLVLSSWRSGSSFVGQLFGQHPDVFY      1 - 70
LMEPAWHVWMTFKQSTAWMLHMAVRDLIRAVFLCDMSVFDAYMEPGPRRQSSLFQWENSRALCSAPACDI     71 - 140
IPQDEIIPRAHCRLLCSQQPFEVVEKACRSYSHVVLKEVRFFNLQSLYPLLKDPSLNLHIVHLVRDPRAV    141 - 210
FRSRERTKGDLMIDSRIVMGQHEQKLKKEDQPYYVMQVICQSQLEIYKTIQSLPKALQERYLLVRYEDLA    211 - 280
RAPVAQTSRMYEFVGLEFLPHLQTWVHNITRGKGMGDHAFHTNARDALNVSQAWRWSLPYEKVSRLQKAC    281 - 350
GDAMNLLGYRHVRSEQEQRNLLLDLLSTWTVPEQIH                                      351 - 386
//

Text Mined References (20)

PMID Year Title