Property Summary

NCBI Gene PubMed Count 19
Grant Count 32
R01 Count 27
Funding $1,639,043.58
PubMed Score 23.68
PubTator Score 18.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.150 0.000
intraductal papillary-mucinous adenoma (... -2.600 0.001
intraductal papillary-mucinous carcinoma... -2.100 0.014
pituitary cancer 1.900 0.000
psoriasis 1.600 0.000

Gene RIF (8)

PMID Text
24799377 A method for O-GlcNAc detection using in vitro sulfation with two N-acetylglucosamine (GlcNAc)-specific sulfotransferases, carbohydrate sulfotransferase 2 and carbohydrate sulfotransferase 4.
19343046 Observational study of gene-disease association. (HuGE Navigator)
19156517 GlcNAc6ST2 could therefore be a good serological marker for detecting early-stage uterine cervical and corpus cancers.
16386360 N-acetylgluosamine-6-O-sulfotransferase is overexpressed in a subgroup of paediatric precursor-B acute lymphoblastic leukaemia
12218059 involved in enzymatic synthesis in vitro of the disulfated disaccharide unit of corneal keratan sulfate
12107080 Ectopic expression of a GlcNAc 6-O-sulfotransferase, GlcNAc6ST-2, in colonic mucinous adenocarcinoma
8419650 Sulfate is linked to the carbohydrate chains of HIV-1 glycoproteins gp160, gp120, and gp41 during the endoplasmic reticulum to Golgi transport of the glycoproteins
1433500 Sulfate is linked to the carbohydrate chains of HIV-1 glycoproteins gp160, gp120, and gp41 during the endoplasmic reticulum to Golgi transport of the glycoproteins

AA Sequence

MLLPKKMKLLLFLVSQMAILALFFHMYSHNISSLSMKAQPERMHVLVLSSWRSGSSFVGQLFGQHPDVFY      1 - 70
LMEPAWHVWMTFKQSTAWMLHMAVRDLIRAVFLCDMSVFDAYMEPGPRRQSSLFQWENSRALCSAPACDI     71 - 140
IPQDEIIPRAHCRLLCSQQPFEVVEKACRSYSHVVLKEVRFFNLQSLYPLLKDPSLNLHIVHLVRDPRAV    141 - 210
FRSRERTKGDLMIDSRIVMGQHEQKLKKEDQPYYVMQVICQSQLEIYKTIQSLPKALQERYLLVRYEDLA    211 - 280
RAPVAQTSRMYEFVGLEFLPHLQTWVHNITRGKGMGDHAFHTNARDALNVSQAWRWSLPYEKVSRLQKAC    281 - 350
GDAMNLLGYRHVRSEQEQRNLLLDLLSTWTVPEQIH                                      351 - 386
//

Text Mined References (19)

PMID Year Title
24799377 2014 Detecting O-GlcNAc using in vitro sulfation.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19156517 2009 N-Acetylglucosamine 6-O-sulfotransferase-2 as a tumor marker for uterine cervical and corpus cancer.
17049924 2006 Sulfated L-selectin ligands as a therapeutic target in chronic inflammation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15752429 2005 A HEV-restricted sulfotransferase is expressed in rheumatoid arthritis synovium and is induced by lymphotoxin-alpha/beta and TNF-alpha in cultured endothelial cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15220337 2004 The stem region of the sulfotransferase GlcNAc6ST-1 is a determinant of substrate specificity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...