Property Summary

NCBI Gene PubMed Count 3
PubMed Score 7.23
PubTator Score 1.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession Q8NCF0 Q8IUW8
Symbols MRCL
MRCL3

Gene

PANTHER Protein Class (1)

AA Sequence

MLHPETSPGRGHLLAVLLALLGTAWAEVWPPQLQEQAPMAGALNRKESFLLLSLHNRLRSWVQPPAADMR      1 - 70
RLDWSDSLAQLAQARAALCGIPTPSLASGLWRTLQVGWNMQLLPAGLASFVEVVSLWFAEGQRYSHAAGE     71 - 140
CARNATCTHYTQLVWATSSQLGCGRHLCSAGQAAIEAFVCAYSPRGNWEVNGKTIVPYKKGAWCSLCTAS    141 - 210
VSGCFKAWDHAGGLCEVPRNPCRMSCQNHGRLNISTCHCHCPPGYTGRYCQVRCSLQCVHGRFREEECSC    211 - 280
VCDIGYGGAQCATKVHFPFHTCDLRIDGDCFMVSSEADTYYRARMKCQRKGGVLAQIKSQKVQDILAFYL    281 - 350
GRLETTNEVIDSDFETRNFWIGLTYKTAKDSFRWATGEHQAFTSFAFGQPDNHGFGNCVELQASAAFNWN    351 - 420
NQRCKTRNRYICQFAQEHISRWGPGS                                                421 - 446
//

Text Mined References (5)

PMID Year Title
26170455 2015 Human CLEC18 Gene Cluster Contains C-type Lectins with Differential Glycan-binding Specificity.
16336259 2005 The C-type lectin-like domain superfamily.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.