Property Summary

NCBI Gene PubMed Count 16
PubMed Score 10.11
PubTator Score 1.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
osteosarcoma -1.104 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.009
colon cancer 1.100 0.003
lung cancer 2.000 0.004
group 3 medulloblastoma 1.300 0.001

Synonym

Accession Q8NCE0 B7Z6K1 C9IZI7 G5E9Q3 Q8WTW7 Q9BPU7
Symbols SEN2
PCH2B
SEN2L

Gene

AA Sequence

MAEAVFHAPKRKRRVYETYESPLPIPFGQDHGPLKEFKIFRAEMINNNVIVRNAEDIEQLYGKGYFGKGI      1 - 70
LSRSRPSFTISDPKLVAKWKDMKTNMPIITSKRYQHSVEWAAELMRRQGQDESTVRRILKDYTKPLEHPP     71 - 140
VKRNEEAQVHDKLNSGMVSNMEGTAGGERPSVVNGDSGKSGGVGDPREPLGCLQEGSGCHPTTESFEKSV    141 - 210
REDASPLPHVCCCKQDALILQRGLHHEDGSQHIGLLHPGDRGPDHEYVLVEEAECAMSEREAAPNEELVQ    211 - 280
RNRLICRRNPYRIFEYLQLSLEEAFFLVYALGCLSIYYEKEPLTIVKLWKAFTVVQPTFRTTYMAYHYFR    281 - 350
SKGWVPKVGLKYGTDLLLYRKGPPFYHASYSVIIELVDDHFEGSLRRPLSWKSLAALSRVSVNVSKELML    351 - 420
CYLIKPSTMTDKEMESPECMKRIKVQEVILSRWVSSRERSDQDDL                             421 - 465
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
18711368 2008 tRNA splicing endonuclease mutations cause pontocerebellar hypoplasia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17495927 2007 The human RNA kinase hClp1 is active on 3' transfer RNA exons and short interfering RNAs.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15109492 2004 Identification of a human endonuclease complex reveals a link between tRNA splicing and pre-mRNA 3' end formation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.