Property Summary

NCBI Gene PubMed Count 16
PubMed Score 10.44
PubTator Score 1.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
colon cancer 1.100 2.8e-03
group 3 medulloblastoma 1.300 1.1e-03
intraductal papillary-mucinous neoplasm ... 1.100 8.7e-03
lung cancer 2.000 4.0e-03
malignant mesothelioma 1.500 3.6e-06
osteosarcoma -1.104 2.7e-05

AA Sequence

MAEAVFHAPKRKRRVYETYESPLPIPFGQDHGPLKEFKIFRAEMINNNVIVRNAEDIEQLYGKGYFGKGI      1 - 70
LSRSRPSFTISDPKLVAKWKDMKTNMPIITSKRYQHSVEWAAELMRRQGQDESTVRRILKDYTKPLEHPP     71 - 140
VKRNEEAQVHDKLNSGMVSNMEGTAGGERPSVVNGDSGKSGGVGDPREPLGCLQEGSGCHPTTESFEKSV    141 - 210
REDASPLPHVCCCKQDALILQRGLHHEDGSQHIGLLHPGDRGPDHEYVLVEEAECAMSEREAAPNEELVQ    211 - 280
RNRLICRRNPYRIFEYLQLSLEEAFFLVYALGCLSIYYEKEPLTIVKLWKAFTVVQPTFRTTYMAYHYFR    281 - 350
SKGWVPKVGLKYGTDLLLYRKGPPFYHASYSVIIELVDDHFEGSLRRPLSWKSLAALSRVSVNVSKELML    351 - 420
CYLIKPSTMTDKEMESPECMKRIKVQEVILSRWVSSRERSDQDDL                             421 - 465
//

Text Mined References (17)

PMID Year Title