Property Summary

NCBI Gene PubMed Count 16
PubMed Score 10.11
PubTator Score 1.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
osteosarcoma -1.104 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.009
colon cancer 1.100 0.003
lung cancer 2.000 0.004
group 3 medulloblastoma 1.300 0.001

Synonym

Accession Q8NCE0 B7Z6K1 C9IZI7 G5E9Q3 Q8WTW7 Q9BPU7
Symbols SEN2
PCH2B
SEN2L

Gene

AA Sequence

MAEAVFHAPKRKRRVYETYESPLPIPFGQDHGPLKEFKIFRAEMINNNVIVRNAEDIEQLYGKGYFGKGI      1 - 70
LSRSRPSFTISDPKLVAKWKDMKTNMPIITSKRYQHSVEWAAELMRRQGQDESTVRRILKDYTKPLEHPP     71 - 140
VKRNEEAQVHDKLNSGMVSNMEGTAGGERPSVVNGDSGKSGGVGDPREPLGCLQEGSGCHPTTESFEKSV    141 - 210
REDASPLPHVCCCKQDALILQRGLHHEDGSQHIGLLHPGDRGPDHEYVLVEEAECAMSEREAAPNEELVQ    211 - 280
RNRLICRRNPYRIFEYLQLSLEEAFFLVYALGCLSIYYEKEPLTIVKLWKAFTVVQPTFRTTYMAYHYFR    281 - 350
SKGWVPKVGLKYGTDLLLYRKGPPFYHASYSVIIELVDDHFEGSLRRPLSWKSLAALSRVSVNVSKELML    351 - 420
CYLIKPSTMTDKEMESPECMKRIKVQEVILSRWVSSRERSDQDDL                             421 - 465
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
18711368 2008 tRNA splicing endonuclease mutations cause pontocerebellar hypoplasia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17495927 2007 The human RNA kinase hClp1 is active on 3' transfer RNA exons and short interfering RNAs.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
More...