Property Summary

NCBI Gene PubMed Count 27
Grant Count 11
R01 Count 6
Funding $2,128,182.63
PubMed Score 21.97
PubTator Score 26.20

Knowledge Summary

Patent

No data available

Expression

Gene RIF (21)

PMID Text
26863619 An increased occurrence of hepatocellular carcinoma was consistently associated with A/C or C/C genotypes of the non-synonymous SNP rs3771333 compared with the A/A genotype in both the Fusui and Haimen populations.
26063729 Authors propose that this centromere expansion activity reflects the functional properties of HJURP, which uses this activity to contribute to the plastic establishment of a centromeric chromatin structure.
25843710 On the basis of our findings, we propose that HJURP serves a dual chaperone function in coordinating CenH3(CENP-A) and CENP-C recruitment.
25497280 HJURP can discriminate favorable and unfavorable outcome within the luminal A subtype, outperforming the currently utilized proliferation marker Ki67, as an independent prognostic marker for luminal A patients.
25243117 3 biomarkers in 44 patients with in situ breast cancers were evaluated: TG2 (transglutaminase 2), HJURP (Holliday junction recognition protein), and HIF-1alpha (hypoxia inducible factor-1 alpha).
25117489 The study describes a novel function for human centromeric long non-coding RNAs in the recruitment of HJURP and CENP-A, implicating RNA-based chaperone targeting in histone variant assembly.
25001279 Phosphorylation state of HJURP controls its centromeric recruitment. HJURP binding to DNA promotes loading of CenH3CENP-A at centromeres.
24519934 Mis18beta binds with and specifies the centromere localization of HJURP.
24039914 The levels of the EDNRB, HJURP and p60/CAF-1 proteins were strongly associated with overall survival in high-grade gliomas patients (p<0.001, p<0.001 and p=0.002, respectively), whereas the one of PDLI4 was not (P=0.11).
23771058 a mechanism whereby the CENP-A pre-nucleosomal complex achieves assembly of the octameric CENP-A nucleosome through the dimerization of the CENP-A chaperone HJURP.
More...

AA Sequence

MLGTLRAMEGEDVEDDQLLQKLRASRRRFQRRMQRLIEKYNQPFEDTPVVQMATLTYETPQGLRIWGGRL      1 - 70
IKERNEGEIQDSSMKPADRTDGSVQAAAWGPELPSHRTVLGADSKSGEVDATSDQEESVAWALAPAVPQS     71 - 140
PLKNELRRKYLTQVDILLQGAEYFECAGNRAGRDVRVTPLPSLASPAVPAPGYCSRISRKSPGDPAKPAS    141 - 210
SPREWDPLHPSSTDMALVPRNDSLSLQETSSSSFLSSQPFEDDDICNVTISDLYAGMLHSMSRLLSTKPS    211 - 280
SIISTKTFIMQNWNSRRRHRYKSRMNKTYCKGARRSQRSSKENFIPCSEPVKGTGALRDCKNVLDVSCRK    281 - 350
TGLKLEKAFLEVNRPQIHKLDPSWKERKVTPSKYSSLIYFDSSATYNLDEENRFRTLKWLISPVKIVSRP    351 - 420
TIRQGHGENRQREIEIRFDQLHREYCLSPRNQPRRMCLPDSWAMNMYRGGPASPGGLQGLETRRLSLPSS    421 - 490
KAKAKSLSEAFENLGKRSLEAGRCLPKSDSSSSLPKTNPTHSATRPQQTSDLHVQGNSSGIFRKSVSPSK    491 - 560
TLSVPDKEVPGHGRNRYDEIKEEFDKLHQKYCLKSPGQMTVPLCIGVSTDKASMEVRYQTEGFLGKLNPD    561 - 630
PHFQGFQKLPSSPLGCRKSLLGSTAIEAPSSTCVARAITRDGTRDHQFPAKRPRLSEPQGSGRQGNSLGA    631 - 700
SDGVDNTVRPGDQGSSSQPNSEERGENTSYRMEEKSDFMLEKLETKSV                          701 - 748
//

Text Mined References (43)

PMID Year Title
27499292 2016 The Flexible Ends of CENP-A Nucleosome Are Required for Mitotic Fidelity.
26863619 2016 A Non-Synonymous Single Nucleotide Polymorphism in the HJURP Gene Associated with Susceptibility to Hepatocellular Carcinoma among Chinese.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26063729 2015 HJURP is involved in the expansion of centromeric chromatin.
25843710 2015 HJURP involvement in de novo CenH3(CENP-A) and CENP-C recruitment.
25497280 2015 The histone chaperone HJURP is a new independent prognostic marker for luminal A breast carcinoma.
25243117 2014 New biomarkers to predict the evolution of in situ breast cancers.
25117489 2014 A long non-coding RNA is required for targeting centromeric protein A to the human centromere.
25001279 2014 Phosphorylation and DNA binding of HJURP determine its centromeric recruitment and function in CenH3(CENP-A) loading.
24519934 2014 Mitotic regulator Mis18? interacts with and specifies the centromeric assembly of molecular chaperone holliday junction recognition protein (HJURP).
More...