Property Summary

NCBI Gene PubMed Count 28
PubMed Score 24.68
PubTator Score 26.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma 1.283 3.1e-03
adult high grade glioma 1.500 1.6e-04
Atopic dermatitis 1.500 3.5e-05
atypical teratoid / rhabdoid tumor 2.300 2.2e-12
Breast cancer 2.100 2.5e-15
colon cancer 1.800 2.8e-02
ductal carcinoma in situ 1.200 8.5e-03
Endometriosis 1.092 1.0e-02
glioblastoma 2.100 1.5e-08
group 3 medulloblastoma 2.400 6.8e-07
intraductal papillary-mucinous carcinoma... 1.100 2.1e-04
intraductal papillary-mucinous neoplasm ... 1.500 1.6e-04
invasive ductal carcinoma 1.300 2.0e-03
lung adenocarcinoma 1.100 2.0e-12
lung cancer 1.200 4.9e-03
medulloblastoma, large-cell 2.800 9.7e-07
non-small cell lung cancer 2.608 3.1e-32
osteosarcoma -2.046 7.9e-03
ovarian cancer 1.800 2.3e-09
posterior fossa group A ependymoma 1.200 2.0e-04
primitive neuroectodermal tumor 2.600 3.0e-05
psoriasis 1.600 4.5e-134

Gene RIF (22)

AA Sequence

MLGTLRAMEGEDVEDDQLLQKLRASRRRFQRRMQRLIEKYNQPFEDTPVVQMATLTYETPQGLRIWGGRL      1 - 70
IKERNEGEIQDSSMKPADRTDGSVQAAAWGPELPSHRTVLGADSKSGEVDATSDQEESVAWALAPAVPQS     71 - 140
PLKNELRRKYLTQVDILLQGAEYFECAGNRAGRDVRVTPLPSLASPAVPAPGYCSRISRKSPGDPAKPAS    141 - 210
SPREWDPLHPSSTDMALVPRNDSLSLQETSSSSFLSSQPFEDDDICNVTISDLYAGMLHSMSRLLSTKPS    211 - 280
SIISTKTFIMQNWNSRRRHRYKSRMNKTYCKGARRSQRSSKENFIPCSEPVKGTGALRDCKNVLDVSCRK    281 - 350
TGLKLEKAFLEVNRPQIHKLDPSWKERKVTPSKYSSLIYFDSSATYNLDEENRFRTLKWLISPVKIVSRP    351 - 420
TIRQGHGENRQREIEIRFDQLHREYCLSPRNQPRRMCLPDSWAMNMYRGGPASPGGLQGLETRRLSLPSS    421 - 490
KAKAKSLSEAFENLGKRSLEAGRCLPKSDSSSSLPKTNPTHSATRPQQTSDLHVQGNSSGIFRKSVSPSK    491 - 560
TLSVPDKEVPGHGRNRYDEIKEEFDKLHQKYCLKSPGQMTVPLCIGVSTDKASMEVRYQTEGFLGKLNPD    561 - 630
PHFQGFQKLPSSPLGCRKSLLGSTAIEAPSSTCVARAITRDGTRDHQFPAKRPRLSEPQGSGRQGNSLGA    631 - 700
SDGVDNTVRPGDQGSSSQPNSEERGENTSYRMEEKSDFMLEKLETKSV                          701 - 748
//

Text Mined References (45)

PMID Year Title