Property Summary

NCBI Gene PubMed Count 24
PubMed Score 48.71
PubTator Score 15.46

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.200 4.0e-03
group 4 medulloblastoma -1.400 3.8e-05
medulloblastoma, large-cell -1.900 1.2e-05
ovarian cancer 1.500 1.3e-06
posterior fossa group B ependymoma -1.100 2.0e-06
tuberculosis 1.200 4.1e-05

Gene RIF (7)

AA Sequence

MGLHLRPYRVGLLPDGLLFLLLLLMLLADPALPAGRHPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTE      1 - 70
SYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHT     71 - 140
MVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQR    141 - 210
QPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEK    211 - 280
VFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDR    281 - 350
DPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP            351 - 412
//

Text Mined References (28)

PMID Year Title