Property Summary

NCBI Gene PubMed Count 23
PubMed Score 31.61
PubTator Score 15.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.27652742250579E-6
posterior fossa group B ependymoma 1530 1.9534259125623E-6
medulloblastoma, large-cell 6234 1.17005974734046E-5
group 4 medulloblastoma 1875 3.7668439508767E-5
tuberculosis 1563 4.05949246313883E-5
diabetes mellitus 1663 0.00404990507105169
Disease Target Count Z-score Confidence
Enamel erosion 15 5.851 2.9
Dentine erosion 3 4.384 2.2

Expression

  Differential Expression (6)

Disease log2 FC p
group 4 medulloblastoma -1.400 0.000
medulloblastoma, large-cell -1.900 0.000
tuberculosis 1.200 0.000
diabetes mellitus -1.200 0.004
posterior fossa group B ependymoma -1.100 0.000
ovarian cancer 1.500 0.000

Synonym

Accession Q8NCC3 B3KMF3 B4DUD1 Q53GZ1 Q9NPQ6 Q9UG04 Q9Y2B3
Symbols ACS
LLPL
LPLA2
LYPLA3
GXVPLA2

Gene

PDB

4X90   4X91   4X92   4X93   4X94   4X95   4X97  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA EggNOG

Gene RIF (6)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19461040 Patients with transient ischemic atack have a high-risk mechanism (large vessel stenosis or cardioembolism) or will experience stroke/death within 90 days. In contrast to CRP, both Lp-PLA(2) mass and activity were associated with this composite end point.
18983494 analyzed the association of five polymorphisms (-1357G>A, -403T>C, Arg92His, Ile198Thr, Ala379Val) and related haplotypes at the PLA2G7 locus with angiographic coronary artery disease, plasma LpPLA2 activity, and long-term survival
14754907 The RXR agonist methoprene acid worked as well as all-trans-retinoic acid at increasing both lysosomal phospholipase A2 mRNA and enzyme activity

AA Sequence

MGLHLRPYRVGLLPDGLLFLLLLLMLLADPALPAGRHPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTE      1 - 70
SYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHT     71 - 140
MVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQR    141 - 210
QPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEK    211 - 280
VFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDR    281 - 350
DPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP            351 - 412
//

Text Mined References (27)

PMID Year Title
25727495 2015 Structure and function of lysosomal phospholipase A2 and lecithin:cholesterol acyltransferase.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23958596 2013 Role of N-glycosylation of human lysosomal phospholipase A2 for the formation of catalytically active enzyme.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20410020 2010 The measurement of lysosomal phospholipase A2 activity in plasma.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19461040 2009 Lipoprotein-associated phospholipase A2 and C-reactive protein for risk-stratification of patients with TIA.
More...