Property Summary

NCBI Gene PubMed Count 9
PubMed Score 42.56
PubTator Score 2.05

Knowledge Summary

Patent (3,078)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.200 1.8e-03
astrocytic glioma -1.400 6.8e-03
Astrocytoma, Pilocytic -2.900 5.0e-08
atypical teratoid / rhabdoid tumor -3.000 1.0e-08
ependymoma -1.600 5.4e-03
glioblastoma -2.100 2.9e-07
group 4 medulloblastoma -1.400 2.8e-02
oligodendroglioma -1.200 1.9e-02
Pick disease -1.300 8.9e-03
primitive neuroectodermal tumor -1.500 4.2e-02
psoriasis -1.300 1.0e-08

Gene RIF (1)

AA Sequence

MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLHTCKKFQKRDGRKVRKAAKNE      1 - 70
IGILKMVKHPNILQLVDVFVTRKEYFIFLELATGREVFDWILDQGYYSERDTSNVVRQVLEAVAYLHSLK     71 - 140
IVHRNLKLENLVYYNRLKNSKIVISDFHLAKLENGLIKEPCGTPEYLAPEVVGRQRYGRPVDCWAIGVIM    141 - 210
YILLSGNPPFYEEVEEDDYENHDKNLFRKILAGDYEFDSPYWDDISQAAKDLVTRLMEVEQDQRITAEEA    211 - 280
ISHEWISGNAASDKNIKDGVCAQIEKNFARAKWKKAVRVTTLMKRLRAPEQSSTAAAQSASATDTATPGA    281 - 350
AGGATAAAASGATSAPEGDAARAAKSDNVAPADRSATPATDGSATPATDGSVTPATDGSITPATDGSVTP    351 - 420
ATDRSATPATDGRATPATEESTVPTTQSSAMLATKAAATPEPAMAQPDSTAPEGATGQAPPSSKGEEAAG    421 - 490
YAQESQREEAS                                                               491 - 501
//

Text Mined References (12)

PMID Year Title