Property Summary

NCBI Gene PubMed Count 9
PubMed Score 40.23
PubTator Score 2.05

Knowledge Summary

Patent (3,078)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
oligodendroglioma 2849 2.27106498587367E-20
ependymoma 2514 5.70293507081622E-11
psoriasis 6685 9.98029078824397E-9
atypical teratoid / rhabdoid tumor 4369 1.00326063329371E-8
pilocytic astrocytoma 3086 7.36546678239443E-8
pediatric high grade glioma 2712 1.98005114988687E-5
glioblastoma 5572 6.37261272843543E-5
astrocytoma 1493 0.00124310528475097
medulloblastoma 1524 0.00200735181799864
Pick disease 1893 0.00893925933391077
primitive neuroectodermal tumor 3031 0.0424858133311724
Disease Target Count Z-score Confidence
Gastrointestinal carcinoma 1 3.023 1.5

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma -2.100 0.001
ependymoma -2.300 0.000
oligodendroglioma -1.600 0.000
glioblastoma -2.500 0.000
medulloblastoma -1.800 0.002
atypical teratoid / rhabdoid tumor -3.000 0.000
primitive neuroectodermal tumor -1.500 0.042
pediatric high grade glioma -2.400 0.000
pilocytic astrocytoma -2.900 0.000
Pick disease -1.300 0.009
psoriasis -1.300 0.000

Synonym

Accession Q8NCB2 A6NFD4 Q6FIB8 Q8NBS8 Q8NC85 Q8NDU4 Q8WTT8 Q9BQC9 Q9H0Q5
Symbols 1G5
VACAMKL

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 Collection (1)

Gene RIF (1)

PMID Text
19367581 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLHTCKKFQKRDGRKVRKAAKNE      1 - 70
IGILKMVKHPNILQLVDVFVTRKEYFIFLELATGREVFDWILDQGYYSERDTSNVVRQVLEAVAYLHSLK     71 - 140
IVHRNLKLENLVYYNRLKNSKIVISDFHLAKLENGLIKEPCGTPEYLAPEVVGRQRYGRPVDCWAIGVIM    141 - 210
YILLSGNPPFYEEVEEDDYENHDKNLFRKILAGDYEFDSPYWDDISQAAKDLVTRLMEVEQDQRITAEEA    211 - 280
ISHEWISGNAASDKNIKDGVCAQIEKNFARAKWKKAVRVTTLMKRLRAPEQSSTAAAQSASATDTATPGA    281 - 350
AGGATAAAASGATSAPEGDAARAAKSDNVAPADRSATPATDGSATPATDGSVTPATDGSITPATDGSVTP    351 - 420
ATDRSATPATDGRATPATEESTVPTTQSSAMLATKAAATPEPAMAQPDSTAPEGATGQAPPSSKGEEAAG    421 - 490
YAQESQREEAS                                                               491 - 501
//

Text Mined References (12)

PMID Year Title
19367581 2010 Identification of neuroglycan C and interacting partners as potential susceptibility genes for schizophrenia in a Southern Chinese population.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
More...