Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.79
PubTator Score 7.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.900 0.007
ependymoma -2.000 0.013
glioblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell -1.500 0.000
adult high grade glioma -1.300 0.001
pilocytic astrocytoma -1.200 0.000
sonic hedgehog group medulloblastoma -1.100 0.001
subependymal giant cell astrocytoma -1.847 0.005
lung carcinoma 1.200 0.000
Pick disease -1.300 0.024
acute myeloid leukemia 1.500 0.002
ovarian cancer 1.700 0.000

Gene RIF (2)

PMID Text
24399846 NECAP1 mutation links trafficking pathway in early infantile epileptic encephalopathy.
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MATELEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKTAYIKLEDKVSGELFA      1 - 70
QAPVEQYPGIAVETVTDSSRYFVIRIQDGTGRSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQESEISKES     71 - 140
QEMDARPKLDLGFKEGQTIKLCIGNITNKKGGASKPRTARGGGLSLLPPPPGGKVTIPPPSSSVAISNHV    141 - 210
TPPPIPKSNHGGSDADILLDLDSPAPVTTPAPTPVSVSNDLWGDFSTASSSVPNQAPQPSNWVQF         211 - 275
//

Text Mined References (14)

PMID Year Title
24399846 2014 NECAP1 loss of function leads to a severe infantile epileptic encephalopathy.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16879712 2006 Characterization of the localization and function of NECAP 1 in neurons.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15494011 2004 Molecular mechanisms in clathrin-mediated membrane budding revealed through subcellular proteomics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...