Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.79
PubTator Score 7.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute myeloid leukemia 1.500 2.5e-03
adult high grade glioma -1.300 9.3e-04
astrocytic glioma -1.900 6.9e-03
Astrocytoma, Pilocytic -1.200 2.2e-06
atypical teratoid / rhabdoid tumor -2.100 9.6e-08
ependymoma -2.000 1.3e-02
glioblastoma -1.300 1.5e-03
lung carcinoma 1.200 3.5e-32
medulloblastoma, large-cell -1.500 3.0e-05
ovarian cancer 1.700 2.9e-04
Pick disease -1.300 2.4e-02
sonic hedgehog group medulloblastoma -1.100 1.1e-03
subependymal giant cell astrocytoma -1.847 5.2e-03

Gene RIF (2)

AA Sequence

MATELEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKTAYIKLEDKVSGELFA      1 - 70
QAPVEQYPGIAVETVTDSSRYFVIRIQDGTGRSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQESEISKES     71 - 140
QEMDARPKLDLGFKEGQTIKLCIGNITNKKGGASKPRTARGGGLSLLPPPPGGKVTIPPPSSSVAISNHV    141 - 210
TPPPIPKSNHGGSDADILLDLDSPAPVTTPAPTPVSVSNDLWGDFSTASSSVPNQAPQPSNWVQF         211 - 275
//

Text Mined References (14)

PMID Year Title