Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
juvenile dermatomyositis 1189 5.00763375587709E-13
glioblastoma 5572 3.02247079494651E-4
adult high grade glioma 2148 6.72829324268225E-4
medulloblastoma, large-cell 6234 0.00196191981318133
Disease Target Count Z-score Confidence
Prostate cancer 172 0.0 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma -1.100 0.000
medulloblastoma, large-cell -1.200 0.002
juvenile dermatomyositis -1.009 0.000
adult high grade glioma -1.200 0.001

AA Sequence

MESFMESLNRLKEIHEKEVLGLQNKLLELNSERCRDAQRIEELFSKNHQLREQQKTLKENLRVLENRLRA      1 - 70
GLCDRCMVTQELARKRQQEFESSHLQNLQRIFILTNEMNGLKEENETLKEEVKRLRGLGDRPKPRAKEGT     71 - 140
SDPPSPLLLPSPGGWKAITEKPPGGHEEAEEDHQGVGLRGEEKPAGHRTSPVAKISPGATLPESRAPDMS    141 - 210
PQRISNQLHGTIAVVRPGSQACPADRGPANGTPPPLPARSSPPSPAYERGLSLDSFLRASRPSAMTHEAP    211 - 280
KLSPKVDRLCLLNRPLSLHLQSPHSSPLAPAAAPSDPRLQDLKAREAEAWEEPTELLGLPSALAGMQDLR    281 - 350
LEGALHLLLAQQQLRARARAGSVRPRGQPTPGEMLPSLPVGSDSEGPENEGTRAALAAAGLSGGRHTQPA    351 - 420
GPGRAQRTEAAATQDCALDKPLDLSEWGRARGQDTPKPAGQHGSLSPAAAHTASPEPPTQSGPLTRSPQA    421 - 490
LSNGTKGTRVPEQEEASTPMDPSRPLPGSQLSLSSPGSTEDEDTGRPLPPPHPQPPPHPQPPDLDGHPEP    491 - 560
SKAEVLRPESDELDETDTPGSEVGLSSQAEATTSTTGEGPECICTQEHGQGPPRKRKRASEPGDKASKKP    561 - 630
SRGRRKLTATEGPGSPRDAEDHSPSPNSSPWEET                                        631 - 664
//

Text Mined References (6)

PMID Year Title
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.