Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
juvenile dermatomyositis 1187 5.0e-13
glioblastoma 5792 3.0e-04
adult high grade glioma 3801 6.7e-04
medulloblastoma, large-cell 6241 2.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Prostate cancer 175 0.0 3.0

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma -1.200 6.7e-04
glioblastoma -1.100 3.0e-04
juvenile dermatomyositis -1.009 5.0e-13
medulloblastoma, large-cell -1.200 2.0e-03

AA Sequence

MESFMESLNRLKEIHEKEVLGLQNKLLELNSERCRDAQRIEELFSKNHQLREQQKTLKENLRVLENRLRA      1 - 70
GLCDRCMVTQELARKRQQEFESSHLQNLQRIFILTNEMNGLKEENETLKEEVKRLRGLGDRPKPRAKEGT     71 - 140
SDPPSPLLLPSPGGWKAITEKPPGGHEEAEEDHQGVGLRGEEKPAGHRTSPVAKISPGATLPESRAPDMS    141 - 210
PQRISNQLHGTIAVVRPGSQACPADRGPANGTPPPLPARSSPPSPAYERGLSLDSFLRASRPSAMTHEAP    211 - 280
KLSPKVDRLCLLNRPLSLHLQSPHSSPLAPAAAPSDPRLQDLKAREAEAWEEPTELLGLPSALAGMQDLR    281 - 350
LEGALHLLLAQQQLRARARAGSVRPRGQPTPGEMLPSLPVGSDSEGPENEGTRAALAAAGLSGGRHTQPA    351 - 420
GPGRAQRTEAAATQDCALDKPLDLSEWGRARGQDTPKPAGQHGSLSPAAAHTASPEPPTQSGPLTRSPQA    421 - 490
LSNGTKGTRVPEQEEASTPMDPSRPLPGSQLSLSSPGSTEDEDTGRPLPPPHPQPPPHPQPPDLDGHPEP    491 - 560
SKAEVLRPESDELDETDTPGSEVGLSSQAEATTSTTGEGPECICTQEHGQGPPRKRKRASEPGDKASKKP    561 - 630
SRGRRKLTATEGPGSPRDAEDHSPSPNSSPWEET                                        631 - 664
//

Text Mined References (6)

PMID Year Title