Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.31
PubTator Score 2.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count Z-score Confidence
Hereditary spherocytosis 16 3.04 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
lung carcinoma 1.700 1.4e-30
medulloblastoma, large-cell -1.100 1.4e-03
ovarian cancer -2.600 3.7e-09
Pick disease -1.400 4.0e-05
subependymal giant cell astrocytoma -1.644 2.2e-02

Synonym

Accession Q8NC69 B3KNI5 Q8NBS6 Q8TCA6
Symbols KCASH3

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MDNGDWGYMMTDPVTLNVGGHLYTTSLTTLTRYPDSMLGAMFGGDFPTARDPQGNYFIDRDGPLFRYVLN      1 - 70
FLRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCLNDPKPLYPMDTFEEVVELSSTRKLSKYSNPVAVII     71 - 140
TQLTITTKVHSLLEGISNYFTKWNKHMMDTRDCQVSFTFGPCDYHQEVSLRVHLMEYITKQGFTIRNTRV    141 - 210
HHMSERANENTVEHNWTFCRLARKTDD                                               211 - 237
//

Text Mined References (15)

PMID Year Title