Property Summary

NCBI Gene PubMed Count 15
PubMed Score 36.94
PubTator Score 12.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.300 0.000
ovarian cancer 1.100 0.001

Synonym

Accession Q8NC60 Q8N7L6 Q9BSQ9
Symbols MTG3
hNOA1
C4orf14
hAtNOS1
mAtNOS1

Gene

PANTHER Protein Class (2)

Gene RIF (4)

PMID Text
25072814 Our results uncovered an unexpected, mandatory detour of NOA1 through the nucleolus before uptake into mitochondria.
22447445 This study indicates rhat C4orf14 is involved in 28S subunit biogenesis and mtDNA maintenance.
20877624 Observational study of gene-disease association. (HuGE Navigator)
18456285 The present study suggests a novel function for mAtNOS1 in regulating mitochondrial nitric oxide and calcium and inducing apoptosis of MCF-7 cells

AA Sequence

MLPARLPFRLLSLFLRGSAPTAARHGLREPLLERRCAAASSFQHSSSLGRELPYDPVDTEGFGEGGDMQE      1 - 70
RFLFPEYILDPEPQPTREKQLQELQQQQEEEERQRQQRREERRQQNLRARSREHPVVGHPDPALPPSGVN     71 - 140
CSGCGAELHCQDAGVPGYLPREKFLRTAEADGGLARTVCQRCWLLSHHRRALRLQVSREQYLELVSAALR    141 - 210
RPGPSLVLYMVDLLDLPDALLPDLPALVGPKQLIVLGNKVDLLPQDAPGYRQRLRERLWEDCARAGLLLA    211 - 280
PGHQGPQRPVKDEPQDGENPNPPNWSRTVVRDVRLISAKTGYGVEELISALQRSWRYRGDVYLVGATNAG    281 - 350
KSTLFNTLLESDYCTAKGSEAIDRATISPWPGTTLNLLKFPICNPTPYRMFKRHQRLKKDSTQAEEDLSE    351 - 420
QEQNQLNVLKKHGYVVGRVGRTFLYSEEQKDNIPFEFDADSLAFDMENDPVMGTHKSTKQVELTAQDVKD    421 - 490
AHWFYDTPGITKENCILNLLTEKEVNIVLPTQSIVPRTFVLKPGMVLFLGAIGRIDFLQGNQSAWFTVVA    491 - 560
SNILPVHITSLDRADALYQKHAGHTLLQIPMGGKERMAGFPPLVAEDIMLKEGLGASEAVADIKFSSAGW    561 - 630
VSVTPNFKDRLHLRGYTPEGTVLTVRPPLLPYIVNIKGQRIKKSVAYKTKKPPSLMYNVRKKKGKINV      631 - 698
//

Text Mined References (19)

PMID Year Title
25072814 2014 NOA1, a novel ClpXP substrate, takes an unexpected nuclear detour prior to mitochondrial import.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22447445 2012 Human C4orf14 interacts with the mitochondrial nucleoid and is involved in the biogenesis of the small mitochondrial ribosomal subunit.
21909106 2011 Genome-wide association study identifies two susceptibility loci for exudative age-related macular degeneration in the Japanese population.
21771794 2011 Nitric oxide-associated protein 1 (NOA1) is necessary for oxygen-dependent regulation of mitochondrial respiratory complexes.
21269460 2011 Initial characterization of the human central proteome.
21118999 2011 NOA1 is an essential GTPase required for mitochondrial protein synthesis.
21106707 2011 A genetic variant near the PMAIP1/Noxa gene is associated with increased bleomycin sensitivity.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
More...