Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.95
PubTator Score 6.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
CATARACT 46, JUVENILE-ONSET 1 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 3.1e-08
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 1.2
Disease Target Count Z-score Confidence
Cataract 297 0.0 4.0
Disease Target Count Z-score Confidence
Emery-Dreifuss muscular dystrophy 23 3.759 1.9
Disease Target Count
Cataract Hutterite type 2

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.613 3.1e-08

 GO Function (1)

Gene RIF (1)

AA Sequence

MAGLSDLELRRELQALGFQPGPITDTTRDVYRNKLRRLRGEARLRDEERLREEARPRGEERLREEARLRE      1 - 70
DAPLRARPAAASPRAEPWLSQPASGSAYATPGAYGDIRPSAASWVGSRGLAYPARPAQLRRRASVRGSSE     71 - 140
EDEDARTPDRATQGPGLAARRWWAASPAPARLPSSLLGPDPRPGLRATRAGPAGAARARPEVGRRLERWL    141 - 210
SRLLLWASLGLLLVFLGILWVKMGKPSAPQEAEDNMKLLPVDCERKTDEFCQAKQKAALLELLHELYNFL    211 - 280
AIQAGNFECGNPENLKSKCIPVMEAQEYIANVTSSSSAKFEAALTWILSSNKDVGIWLKGEDQSELVTTV    281 - 350
DKVVCLESAHPRMGVGCRLSRALLTAVTNVLIFFWCLAFLWGLLILLKYRWRKLEEEEQAMYEMVKKIID    351 - 420
VVQDHYVDWEQDMERYPYVGILHVRDSLIPPQSRRRMKRVWDRAVEFLASNESRIQTESHRVAGEDMLVW    421 - 490
RWTKPSSFSDSER                                                             491 - 503
//

Text Mined References (28)

PMID Year Title