Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 7.1e-08
breast carcinoma 1.200 6.3e-03
dermatomyositis 1.300 3.6e-04
esophageal adenocarcinoma 1.300 2.2e-02
Multiple myeloma 1.464 2.9e-04
ovarian cancer -1.700 2.1e-06

AA Sequence

MAAAVPKRMRGPAQAKLLPGSAIQALVGLARPLVLALLLVSAALSSVVSRTDSPSPTVLNSHISTPNVNA      1 - 70
LTHENQTKPSISQISTTLPPTTSTKKSGGASVVPHPSPTPLSQEEADNNEDPSIEEEDLLMLNSSPSTAK     71 - 140
DTLDNGDYGEPDYDWTTGPRDDDESDDTLEENRGYMEIEQSVKSFKMPSSNIEEEDSHFFFHLIIFAFCI    141 - 210
AVVYITYHNKRKIFLLVQSRKWRDGLCSKTVEYHRLDQNVNEAMPSLKITNDYIF                   211 - 265
//

Text Mined References (12)

PMID Year Title