Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
pilocytic astrocytoma 3086 4.40405996263956E-8
ovarian cancer 8492 2.14076472037551E-6
Multiple myeloma 1328 2.89051255966553E-4
dermatomyositis 967 3.55409125108745E-4
breast carcinoma 1614 0.00626190765294519
esophageal adenocarcinoma 737 0.0217731605213828

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.464 0.000
esophageal adenocarcinoma 1.300 0.022
breast carcinoma 1.200 0.006
pilocytic astrocytoma 1.100 0.000
ovarian cancer -1.700 0.000
dermatomyositis 1.300 0.000

Synonym

Accession Q8NC54 B2RD10 D3DQ92 Q9NRG2
Symbols KCT2
HTGN29

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken EggNOG Inparanoid

AA Sequence

MAAAVPKRMRGPAQAKLLPGSAIQALVGLARPLVLALLLVSAALSSVVSRTDSPSPTVLNSHISTPNVNA      1 - 70
LTHENQTKPSISQISTTLPPTTSTKKSGGASVVPHPSPTPLSQEEADNNEDPSIEEEDLLMLNSSPSTAK     71 - 140
DTLDNGDYGEPDYDWTTGPRDDDESDDTLEENRGYMEIEQSVKSFKMPSSNIEEEDSHFFFHLIIFAFCI    141 - 210
AVVYITYHNKRKIFLLVQSRKWRDGLCSKTVEYHRLDQNVNEAMPSLKITNDYIF                   211 - 265
//

Text Mined References (12)

PMID Year Title
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12752121 2003 Identification of novel genes for secreted and membrane-anchored proteins in human keratinocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
More...