Property Summary

NCBI Gene PubMed Count 39
PubMed Score 15.28
PubTator Score 14.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
aldosterone-producing adenoma -1.238 4.1e-02
atypical teratoid / rhabdoid tumor 1.100 5.8e-05
Breast cancer 3.000 2.7e-02
ependymoma 1.200 4.8e-07
group 3 medulloblastoma 1.300 1.2e-02
hereditary spastic paraplegia -1.675 2.1e-03
lung adenocarcinoma 1.242 4.5e-05
lung cancer 1.200 4.2e-03
medulloblastoma, large-cell 2.000 6.2e-06
Multiple myeloma 1.920 1.5e-04
osteosarcoma 1.821 8.5e-05
pancreatic ductal adenocarcinoma liver m... -1.038 4.3e-02
pediatric high grade glioma 1.100 2.1e-03
Pick disease 1.100 1.5e-04
psoriasis 1.300 9.6e-04
Waldenstrons macroglobulinemia 1.761 1.3e-03

Gene RIF (18)

AA Sequence

MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQL      1 - 70
RKESQKDRKNPLPPSVGVVDKKEETQPPVALKKEGIRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFEK     71 - 140
PLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSGSDRSSFSHYSGL    141 - 210
KHEDKRGGSGSHNWGTVKDELTESPKYIQKQISYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEV    211 - 280
KEEGPKEMTLDEWKAIQNKDRAKVEFNIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPAND    281 - 350
ITSQLEINFGDLGRPGRGGRGGRGGRGRGGRPNRGSRTDKSSASAPDVDDPEAFPALA                351 - 408
//

Text Mined References (57)

PMID Year Title