Property Summary

NCBI Gene PubMed Count 35
Grant Count 9
R01 Count 6
Funding $1,230,812.36
PubMed Score 13.17
PubTator Score 14.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.761 0.001
Multiple myeloma 1.920 0.000
psoriasis 1.300 0.001
osteosarcoma 1.821 0.000
ependymoma 1.200 0.000
group 3 medulloblastoma 1.300 0.012
atypical teratoid/rhabdoid tumor 1.300 0.000
medulloblastoma, large-cell 2.000 0.000
hereditary spastic paraplegia -1.675 0.002
primary pancreatic ductal adenocarcinoma -1.143 0.004
lung cancer 1.200 0.004
Breast cancer 3.000 0.027
pediatric high grade glioma 1.100 0.002
aldosterone-producing adenoma -1.238 0.041
lung adenocarcinoma 1.242 0.000
Pick disease 1.100 0.000

Gene RIF (14)

PMID Text
26398198 SERBP1 is a component of the LRH-1 transcriptional complex.
24374978 Pseudomyogenic haemangioendothelioma consistently displays a SERPINE1-FOSB fusion gene, resulting from a translocation between chromosomes 7 and 19.
23236990 The RNA-binding protein SERBP1 is abundantly expressed in human breast cancer and may represent a novel breast tumour marker with prognostic significance
22442049 The RG-rich and RGG box of SERBP1 is asymmetrically dimethylated by PRMT1 and the modification affects protein interaction and intracellular localization of the protein.
22373659 PAI-RBP1 expression level is higher in non-small lung cancer tissues than in normal tissues.
18440126 The aim of this study was to assess the expression, localization and hormonal regulation of two novel P(4) receptor candidates, P(4) receptor membrane component (PGRMC) 1 and PGRMC2, as well as the PGRMC1 partner Serpine 1 mRNA binding protein (SERBP1).
17698176 In ovarian cancer, PAI-RBP1 is significantly overexpressed in tumor epithelial cells, suggesting a biological role in tumor invasion and metastasis. Its expression is higher in advanced disease.
16963292 The presence of the genotype risk factors alone does not seem to be associated with the development of preeclampsia even in the severe presentation form. PAI-1 gene polymorphisms on the development of the preeclampsia was indicated.
16879614 Has two conserved Gly/Arg-rich motif clusters (RGG/RXR box, where X is any amino acid) that may be substrates for arginine-methylation by protein arginine-methyltransferase-1 (PRMT1).
16679534 We observed that CGI-55 localizes to the nucleolus and co-localizes with p80-coilin positive nuclear-coiled bodies.
More...

AA Sequence

MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQL      1 - 70
RKESQKDRKNPLPPSVGVVDKKEETQPPVALKKEGIRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFEK     71 - 140
PLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSGSDRSSFSHYSGL    141 - 210
KHEDKRGGSGSHNWGTVKDELTESPKYIQKQISYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEV    211 - 280
KEEGPKEMTLDEWKAIQNKDRAKVEFNIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPAND    281 - 350
ITSQLEINFGDLGRPGRGGRGGRGGRGRGGRPNRGSRTDKSSASAPDVDDPEAFPALA                351 - 408
//

Text Mined References (51)

PMID Year Title
26398198 2015 SERBP1 Is a Component of the Liver Receptor Homologue-1 Transcriptional Complex.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24374978 2014 A novel SERPINE1-FOSB fusion gene results in transcriptional up-regulation of FOSB in pseudomyogenic haemangioendothelioma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...