Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.29
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
acute quadriplegic myopathy 1157 5.25354977055938E-8
ovarian cancer 8492 3.76275696494193E-7
atypical teratoid / rhabdoid tumor 4369 6.50069327496991E-6
psoriasis 6685 1.23914072566164E-5
osteosarcoma 7933 2.61042190412858E-5
lung cancer 4473 5.1180632112822E-5
medulloblastoma, large-cell 6234 8.04716910490798E-5
group 4 medulloblastoma 1875 8.80084814656426E-5
adult high grade glioma 2148 1.89874366967731E-4
ulcerative colitis 2087 4.29520358120168E-4
primitive neuroectodermal tumor 3031 4.50187817841572E-4
chronic lymphocytic leukemia 244 0.00698368562999029
subependymal giant cell astrocytoma 2287 0.0148986740486844
non primary Sjogren syndrome sicca 840 0.0426929181024069

Expression

  Differential Expression (14)

Synonym

Accession Q8NC44 Q6P1P5 Q9H0K7
Symbols MAG-2
C2orf17

Gene

Gene RIF (1)

PMID Text
19212629 MAG-2 may be a novel causal gene for lung cancer invasion and metastasis.

AA Sequence

MASGGGGGNTGAGGGPGMGLSLGLGLGLSLGMSEATSEAEEEAATAEAVGRLATTLWLRLRGWEAVLAAA      1 - 70
QRLLVWEKPLHSLVTAAALNGLFWLLSSSSLRPFFLLSVSLLAYFLLDLWQPRFLPDVSASSPEEPHSDS     71 - 140
EGAGSGARPHLLSVPELCRYLAESWLTFQIHLQELLQYKRQNPAQFCVRVCSGCAVLAVLGHYVPGIMIS    141 - 210
YIVLLSILLWPLVVYHELIQRMYTRLEPLLMQLDYSMKAEANALHHKHDKRKRQGKNAPPGGDEPLAETE    211 - 280
SESEAELAGFSPVVDVKKTALALAITDSELSDEEASILESGGFSVSRATTPQLTDVSEDLDQQSLPSEPE    281 - 350
ETLSRDLGEGEEGELAPPEDLLGRPQALSRQALDSEEEEEDVAAKETLLRLSSPLHFVNTHFNGAGSPPD    351 - 420
GVKCSPGGPVETLSPETVSGGLTALPGTLSPPLCLVGSDPAPSPSILPPVPQDSPQPLPAPEEEEALTTE    421 - 490
DFELLDQGELEQLNAELGLEPETPPKPPDAPPLGPDIHSLVQSDQEAQAVAEP                     491 - 543
//

Text Mined References (21)

PMID Year Title
26040720 2015 Regulation of endoplasmic reticulum turnover by selective autophagy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21310131 2003 [Identification of novel metastasis associated genes MAG-1 and MAG-2].
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19212629 2009 MAG-2 promotes invasion, mobility and adherence capability of lung cancer cells by MMP-2, CD44 and intracellular calcium in vitro.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
More...