Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.22

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
Astrocytoma, Pilocytic 1.700 2.7e-06
atypical teratoid / rhabdoid tumor 1.200 1.5e-02
medulloblastoma 1.100 6.3e-03
posterior fossa group A ependymoma 1.100 7.0e-04
primitive neuroectodermal tumor 1.400 7.0e-03

AA Sequence

MSQDSVTFADVAVNFTKEEWTLLDPAQRNLYRDVMLENSRNLAFIDWATPCKTKDATPQPDILPKRTFPE      1 - 70
ANRVCLTSISSQHSTLREDWRCPKTEEPHRQGVNNVKPPAVAPEKDESPVSICEDHEMRNHSKPTCRLVP     71 - 140
SQGDSIRQCILTRDSSIFKYNPVLNDSQKTHENNEDDGVLGWNIQWVPCGRKTELKSSTWTGSQNTVHHI    141 - 210
RDEIDTGANRHQRNPFGKAFREDGSLRAHNTHGREKMYDFTQCENTSRNNSIHAMQMQLYTAETNKKDCQ    211 - 280
TGATSANAPNSGSHKSHCTGEKTHKCPECGRAFFYQSFLMRHMKIHTGEKPYECGKCGKAFRYSLHLNKH    281 - 350
LRKHVVQKKPYECEECGKVIRESSKYTHIRSHTGEKPYKCKTCGKDFAKSSGLKKHLKTHKDEKPCE       351 - 417
//

Text Mined References (6)

PMID Year Title