Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
pilocytic astrocytoma 3086 1.57489039763461E-6
posterior fossa group A ependymoma 1511 6.98991072304079E-4
atypical teratoid / rhabdoid tumor 4369 8.1285539259861E-4
primitive neuroectodermal tumor 3031 0.00161346160738386
sonic hedgehog group medulloblastoma 1482 0.00685870914748583

Expression

Synonym

Accession Q8NC26 A8K6B0 Q08AQ6
Symbols

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG

AA Sequence

MSQDSVTFADVAVNFTKEEWTLLDPAQRNLYRDVMLENSRNLAFIDWATPCKTKDATPQPDILPKRTFPE      1 - 70
ANRVCLTSISSQHSTLREDWRCPKTEEPHRQGVNNVKPPAVAPEKDESPVSICEDHEMRNHSKPTCRLVP     71 - 140
SQGDSIRQCILTRDSSIFKYNPVLNDSQKTHENNEDDGVLGWNIQWVPCGRKTELKSSTWTGSQNTVHHI    141 - 210
RDEIDTGANRHQRNPFGKAFREDGSLRAHNTHGREKMYDFTQCENTSRNNSIHAMQMQLYTAETNKKDCQ    211 - 280
TGATSANAPNSGSHKSHCTGEKTHKCPECGRAFFYQSFLMRHMKIHTGEKPYECGKCGKAFRYSLHLNKH    281 - 350
LRKHVVQKKPYECEECGKVIRESSKYTHIRSHTGEKPYKCKTCGKDFAKSSGLKKHLKTHKDEKPCE       351 - 417
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8467795 1993 Clustered organization of homologous KRAB zinc-finger genes with enhanced expression in human T lymphoid cells.