Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.99
PubTator Score 2.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
cutaneous lupus erythematosus 1.100 0.030
osteosarcoma -1.262 0.044
atypical teratoid / rhabdoid tumor 1.300 0.003
glioblastoma 1.600 0.001
medulloblastoma 1.100 0.008
medulloblastoma, large-cell 1.600 0.000
non-small cell lung carcinoma -1.900 0.000
lung cancer -4.600 0.000
interstitial cystitis 1.400 0.000
lung adenocarcinoma -1.500 0.000
adult high grade glioma 1.500 0.002
Pneumonia 1.300 0.019
lung carcinoma -2.100 0.000
invasive ductal carcinoma -1.200 0.003
ovarian cancer 1.800 0.000

Gene RIF (1)

PMID Text
22117783 Expression of CLEC-1 mRNA was detected in myeloid cells as well as in endothelial cells. CLEC-1 protein displayed N-linked glycosylation and formed dimers.

AA Sequence

MQAKYSSTRDMLDDDGDTTMSLHSQGSATTRHPEPRRTEHRAPSSTWRPVALTLLTLCLVLLIGLAALGL      1 - 70
LFFQYYQLSNTGQDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEKLCRELYNKAGAHRCSPCTEQ     71 - 140
WKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQEDLEFAASQSYSEFFYSYWTGLLRPDSGKAWL    141 - 210
WMDGTPFTSELFHIIIDVTSPRSRDCVAILNGMIFSKDCKELKRCVCERRAGMVKPESLHVPPETLGEGD    211 - 280
//

Text Mined References (11)

PMID Year Title
22117783 2012 The human C-type lectin-like receptor CLEC-1 is upregulated by TGF-? and primarily localized in the endoplasmic membrane compartment.
17046204 2007 Dendritic cell immunoreceptors: C-type lectin receptors for pattern-recognition and signaling on antigen-presenting cells.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12945048 2003 Evolutionary analysis reveals collective properties and specificity in the C-type lectin and lectin-like domain superfamily.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11745369 2001 A novel cluster of lectin-like receptor genes expressed in monocytic, dendritic and endothelial cells maps close to the NK receptor genes in the human NK gene complex.
10671229 2000 Molecular characterization of two novel C-type lectin-like receptors, one of which is selectively expressed in human dendritic cells.
More...