Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.05
PubTator Score 2.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 1.500 2.1e-03
atypical teratoid / rhabdoid tumor 1.300 2.6e-03
cutaneous lupus erythematosus 1.100 3.0e-02
glioblastoma 1.600 9.3e-04
interstitial cystitis 1.100 1.6e-02
invasive ductal carcinoma -1.200 3.2e-03
lung adenocarcinoma -1.500 7.2e-16
lung cancer -4.600 2.9e-05
lung carcinoma -2.100 2.2e-16
medulloblastoma 1.100 7.6e-03
medulloblastoma, large-cell 1.600 5.0e-04
non-small cell lung cancer -1.746 3.6e-24
osteosarcoma -1.262 4.4e-02
ovarian cancer 1.800 3.4e-12
Pneumonia 1.300 1.9e-02

Gene RIF (1)

AA Sequence

MQAKYSSTRDMLDDDGDTTMSLHSQGSATTRHPEPRRTEHRAPSSTWRPVALTLLTLCLVLLIGLAALGL      1 - 70
LFFQYYQLSNTGQDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEKLCRELYNKAGAHRCSPCTEQ     71 - 140
WKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQEDLEFAASQSYSEFFYSYWTGLLRPDSGKAWL    141 - 210
WMDGTPFTSELFHIIIDVTSPRSRDCVAILNGMIFSKDCKELKRCVCERRAGMVKPESLHVPPETLGEGD    211 - 280
//

Text Mined References (11)

PMID Year Title